KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1894Help
Entry
BT9727_1894       CDS       T00179                                 

Gene name
dal
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00473  D-Alanine metabolism
btk01100  Metabolic pathways
btk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BT9727_1894 (dal)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BT9727_1894 (dal)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btk01011]
    BT9727_1894 (dal)
Enzymes [BR:btk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BT9727_1894 (dal)
Peptidoglycan biosynthesis and degradation proteins [BR:btk01011]
 Precursor biosynthesis
  Racemase
   BT9727_1894 (dal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Urease_linker DUF4170
Motif
Other DBs
NCBI-GeneID: 2855421
NCBI-ProteinID: YP_036225
UniProt: Q6HJQ1
LinkDB All DBs
Position
1976297..1977472
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKAAIEAG
INQLAVAFVDEAIELREAGINVPILILGYTSVASAEEAIQYDVMMTVYRSEDLQGINEIA
NRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVVGMFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMELSNTFQNMVRVGIGIYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
HALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEITCMLDRRIPRVYKENNETTAIVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacat
aatgtaaaagaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgta
aaagcgaatgggtatggtcatggggcagttgaagttgcaaaagctgctattgaagcagga
ataaatcagcttgcagttgcatttgtagatgaagcgatagagttaagagaagcaggaatt
aacgtgccgattttaattttaggctatacatcagtagcatctgcggaagaagcaattcaa
tatgacgttatgatgactgtttatagaagtgaagatttacaaggtataaatgaaatcgca
aaccgtcttcaaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcatt
ggtttacaggaagaagaggttaaaccatttttagaagaattaaaacgtatggagtatgta
gaggtagtaggaatgtttacacattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcat
attccatatattcatagttcaaatagtgcaggttcaatggaacttagcaatacatttcaa
aatatggttcgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtagatcat
tcagttgtttcgttacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcat
gcgaagaaaaatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatgg
attgccactgtacctattggttatgctgatggttataatcgtcagttatctaataaaggg
catgcattaataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctc
atgttagacgtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggt
aaacaaggcgaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaac
tatgaaattacatgtatgttagatagaagaattccacgtgtgtataaagaaaataatgaa
acgactgctattgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system