KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_3261Help
Entry
BT9727_3261       CDS       T00179                                 

Gene name
amyS
Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00500  Starch and sucrose metabolism
btk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BT9727_3261 (amyS)
Enzymes [BR:btk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BT9727_3261 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-GeneID: 2854827
NCBI-ProteinID: YP_037583
UniProt: Q6HFU3
LinkDB All DBs
Position
complement(3326056..3327597)
Genome map
AA seq 513 aa AA seqDB search
MFKKITIVGLSVVLFLPSIYGGSKVYADTINNGTLMQYFEWYAPSDGNHWNRLRTDAENL
AQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHK
QNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTRKEMFTVAEYWQNDIHTL
NNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQ
PGQSLESVVSAWFKPLAYGFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTA
RKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWH
DMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaataacaatagtcggcttgtcggttgttttgtttttacctagtatatat
ggggggagtaaagtgtatgcagatacgattaacaatggaacgttaatgcagtattttgag
tggtatgctccaagtgatgggaatcattggaatcgtttgcgcactgatgctgaaaattta
gcgcaaaaaggaattacatctgtttggatacctcctgcgtataaaggaactacgcaaaat
gatgtaggatatggagcatatgatttatatgatttgggtgaattcaatcaaaagggaaca
gtgcggacgaaatatgggacgaaagcacaattgaaatctgcaattgaagctttacataag
caaaacatcgatgtatacggcgatgtagttatgaatcataaaggtggagcagattatacg
gaaactgtaacagctgttgaggtagaccgtaacaatcgaaatgttgaggtatcaggtgat
tatgaaattagtgcatggacagggtttaactttcctggacgtggagataattattctaat
ttcaaatggaaatggtatcattttgacggaacggattgggatgaaggaaggaaattaaat
cgaatttataaatttaggggtataggtaaagcatgggactgggaagtgtctagtgagaat
ggaaattatgattatttgatgtatgcagaccttgattttgatcatccagatgttgcgaat
gagatgaaaaattgggggacgtggtatgcgaatgaattaaatttagatggctttcgttta
gatgctgttaaacatattgatcatgaatatttacgcgattgggtaaatcatgttaggcag
caaacgaggaaagaaatgtttacggtggctgaatattggcaaaatgatatccacacttta
aataattatttagcgaaagtcaattataatcaatctgtatttgatgcaccactgcattac
aattttcattatgcttcaaaaggaaatgggaattatgatatgagaaatattttaaatgga
acagtaatgcaaaatcatcctgcactcgcagttactcttgttgagaatcatgattctcag
cctggtcagtcattggaatctgtagtaagtgcgtggtttaaaccgttggcatatggattt
attttaactcgtgcagagggatatccttcagttttttatggtgattactatgggacaagc
ggaaatagtagttatgaaattccagcgttaaaagataaaattgatccgattttgacagca
cgaaaaaactttgcatatggtacgcagcgtgattatttagaccatccagatgtgattgga
tggacaagagaaggtgatagtgtacatgctaattctggtttagcaacattaatctctgat
ggaccgggaggatcaaagtggatggatgttggaaagaataatgcaggggaagtatggcac
gatatgacgggtaatcaaacaaatactgtaacaattaataaggatggatgggggcaattc
catgtaagtggaggatcagtttccatatatgttcagcagtga

DBGET integrated database retrieval system