KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_3603Help
Entry
BT9727_3603       CDS       T00179                                 

Definition
(RefSeq) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Brite
KEGG Orthology (KO) [BR:btk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:btk01001]
    BT9727_3603
Enzymes [BR:btk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BT9727_3603
Protein kinases [BR:btk01001]
 Serine/threonine kinases: Other
  Bacterial family
   BT9727_3603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kinase-like Haspin_kinase Kdo ETRAMP Fructosamin_kin
Motif
Other DBs
NCBI-GeneID: 2853971
NCBI-ProteinID: YP_037923
UniProt: Q6HEV3
LinkDB All DBs
Position
complement(3699078..3701051)
Genome map
AA seq 657 aa AA seqDB search
MLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREA
QSVTTLSHPNIVNMYDVGEEDGIYYLVMEYVPGQTLKQYIIERGMLPIGEALDIMEQLTS
AMAHAHHFEIVHRDIKPHNILIRADGVIKVTDFGIATATSATTITHTNSVLGSVHYLSPE
QARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPKRWNENIPQS
VENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQ
LFENVTDETIVLKGSKVDEQIRKEETDLSKKKKRSNKWLKILITTFLLLAIGITLALTVI
PGFFIPKDVKVPDVAGMKYTTAVNTLVEKGFEVTEPNIVYTDDVETGDVIKTDPVAGRVV
KENSKITIYQSGGKKKSKMIDFTGKDLESIRTELEEKYKQVTVYYIEDDRPKGAIVEQIP
TSDQMVVEAEQELKIWVSKGPYQIRPGDFSRWTENSVTGYLNERKLTPDIKREYSDTVDK
GLVISQSPKPGTPLKEGDKVTIIISEGPKPKVTKTVKVDNISIPYESSIIGEKKPQTIEI
YKEDMQQKMDRPIETRTISESATISLEFVIQEDTKGRYKIVRDGVTIIDKEVPYPTQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaaaacgcttaaatgaccgttataagctgctgaaaatgattggtggcggt
ggaatggccaatgtgtatttagctcatgatgatatactgggccgggatgtagcggtgaaa
atattaagactcgactattcaaataacgaagagtttattaaacgtttccatcgagaagcg
cagtctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgtcggagaagag
gatggtatatattatcttgtaatggagtatgtaccaggacaaacattgaagcaatacata
attgagcgaggaatgttacctattggagaagctcttgacataatggagcagttaacatcc
gccatggcacacgcccatcattttgaaattgtgcatcgtgatattaaaccgcacaatatt
ttaattcgagctgatggagtaataaaagtaacagattttggaattgcgacagctacaagt
gcaacaacaattacacatacaaattcagtactcggttcggtgcattatttatcaccagaa
caagcacgcggtgggatagcaaataaacaatcagatatttattccctagggatcgttatg
tttgagttgttaacaggaagacaaccgttttctggcgaatctgctgttgctatagcttta
aaacatttacaaagtgaaattccatctccaaaaagatggaatgaaaatattcctcaaagt
gtcgaaaatattatattaaaggcaactgcgaaagatccatttcatcgatatcaatctgcc
aatgcgatgaaacgagatattgaaactgcgctatatccagagaggataaatgagcagcca
ttttacataccggaagatatggaagcgacaaaagcgattccgattattcaacaagaacaa
ttattcgaaaatgttactgatgaaacaattgttttaaaaggaagtaaagtggatgaacag
ataagaaaagaagaaacggatttaagtaagaagaaaaaacgaagtaataaatggctcaaa
attttaattacaacatttttactgttagcgattggaataacgttagcgcttactgttatt
ccaggattctttattccaaaagatgtaaaagtacctgatgtggctggtatgaaatatacg
acagcagtaaatacattagttgaaaagggttttgaagttacggaacctaatattgtatat
acagatgatgttgaaaccggtgacgttataaaaacagaccccgtagcaggtagagtcgtg
aaagaaaactctaaaattactatctatcaatcaggtgggaaaaagaaaagtaagatgatt
gatttcacaggaaaagatttagagagtataagaacagagttagaagagaaatataaacaa
gttacagtatattatattgaagatgataggccgaaaggtgcaattgtagagcaaattccg
acgtctgaccaaatggtggtagaggccgagcaagaactgaaaatctgggtaagtaaaggc
ccttatcaaattagaccgggtgatttttcaaggtggactgaaaatagtgtaactggttat
ttgaatgagagaaaactaactccagatataaaacgagagtattccgatactgttgataaa
ggacttgtaatttcgcaatctccaaaaccgggaacgccgttaaaagaaggggataaagtg
acgattatcatctcagagggccctaagccgaaagtaacgaaaaccgtgaaagtggataat
atttctattccgtatgagtcttctataataggtgagaaaaaaccgcaaacaatagaaatt
tataaagaagatatgcaacaaaaaatggatagaccaattgaaactagaacaatttcagag
tcggcaactatttcattagaatttgtaattcaagaagatacaaaaggacgctataaaatt
gtaagagatggtgtaacgattattgacaaagaagtaccatatccaacacaataa

DBGET integrated database retrieval system