KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_4322Help
Entry
BT9727_4322       CDS       T00179                                 

Gene name
citC
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00020  Citrate cycle (TCA cycle)
btk00480  Glutathione metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
btk01130  Biosynthesis of antibiotics
btk01200  Carbon metabolism
btk01210  2-Oxocarboxylic acid metabolism
btk01230  Biosynthesis of amino acids
Module
btk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:btk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BT9727_4322 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BT9727_4322 (citC)
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BT9727_4322 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 2857583
NCBI-ProteinID: YP_038637
UniProt: Q6HCT9
LinkDB All DBs
Position
complement(4390886..4392193)
Genome map
AA seq 435 aa AA seqDB search
MGVITLTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKK
IVWKEVLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDL
YVCLRPVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMG
VNKIRFPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNW
GYEVAEQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILT
RPREFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLD
KVNPSSVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFA
NELIKNMDVAIIKNA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggggttatcacattgacgacaggtgaaaaaattactgtaactaatggtgttatgaat
gtaccaaacaatccgattattccatttatcgaaggagatggaattggtcctgatatttgg
gcagctgcatctcgtgtactagaagcagcagttgaaaaagcttatgatggtgagaagaaa
atcgtttggaaagaagtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggtta
ccagaagaaactttaaatttaattcgtgaatatttaatcgcgattaaaggtccacttaca
actccagttggcggtggtattcgttctctaaacgtagcacttcgtcaagaattagattta
tatgtatgtctacgtccagttcgttattttgaaggtgttccttcacctgtaaaacgtccg
gaagatactgatatggttattttccgtgaaaatacagaagacatttatgctggaattgaa
tatgcgcaaggatctccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggt
gttaataaaatccgcttcccagaaacatctggtattggtattaaaccaatctcagaagaa
ggaacaaagcgtcttgttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttct
gttacattagttcataaaggaaacattatgaaattcacagaaggtgctttcaaaaactgg
ggttacgaagtagcggaacaagaattcggcgacaaagtatttacttgggctgaatatgat
cgcatcgttgagaaagatggtaaagatgcagcgaataaagcgatggcagacgctgaagtg
gctggaaaaatcatcgtaaaagattctattgcagacatcttcttacaacaaattttaact
cgtccacgtgagttcgatgttgttgcaacaatgaacttaaacggagactacatctctgat
gcacttgctgcacaagtaggtggaattggtattgcacctggtgcaaacattaactatgta
actggacatgctatctttgaagctacgcacggtacagctccaaaatatgcaggtttagat
aaagtaaacccatcttcagttcttctttctggtgtattattattagagcacttaggatgg
aacgaagctgcgaaattagtaactgcttcagttgagaaaacaattgcttcaaaagtagta
acttatgatttcgcacgcttaatggaaggtgcaacagaagtgaaatgttctgagttcgct
aatgaacttattaaaaacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system