KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_4941Help
Entry
BT9727_4941       CDS       T00179                                 

Definition
(RefSeq) ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:btk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BT9727_4941
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btk02000]
    BT9727_4941
Transporters [BR:btk02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    BT9727_4941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_1 SBP_bac_11
Motif
Other DBs
NCBI-GeneID: 2858772
NCBI-ProteinID: YP_039250
UniProt: Q6HB26
LinkDB All DBs
Position
complement(4994576..4995610)
Genome map
AA seq 344 aa AA seqDB search
MRKIAFFFFLLVIGGAMSSCSRDTTSIKYNNSGLPILDDRHLVAYVAAREEVGEALLSSF
CKSRGCTYEFIRLSTEELLRRVEEEAGNPKADIIIGGTVDAHQMMKQKNLSIPVTSQHAN
RISKTVKDKDGYWYGYEVEKLAIAINKERWNEEIAPLGLPYPSRWQDLLNPVYKEKVVMP
DPNVSGTAYTFFQSLIDTVGEEEAKEYVKSFAGQVGEVTVNGYMPVELVASGEYMIGINF
MGDQRMLQKQGFPVVSIVPEQTGLSVNAISKLKRAPNGIIADLFIDYCLSEEAGHILEKV
SFGVPTMFAKNEKEIEGQPVRRTNQNISNSGIIEIWNRQRLSQK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatagcctttttcttctttttgctagtaattggaggagcgatgtctagttgc
tctcgagatacgacctctattaaatataataatagtggtctccctattttggatgatcgt
catcttgttgcgtatgtagcggctcgcgaggaagtgggggaagcgttgctttcatcattt
tgtaaatcacgcggctgtacgtatgaatttattcgcctttcgacagaagagcttcttcgg
agggtagaagaggaagctggaaatccgaaagcggatattattattggcggtacggtagat
gcgcatcaaatgatgaagcaaaaaaacctatctattcctgttacgagccagcatgcgaac
cgtatttcaaaaactgttaaagataaagacggttattggtacggttatgaagtagagaag
ctggcaattgcgatcaataaagagcggtggaacgaagaaatagcaccgctcggacttcct
tatccatcaaggtggcaagatttattaaatccagtatataaggaaaaggttgttatgcca
gatccaaatgtttcaggaacagcatatacgttttttcaatcacttattgatactgtaggt
gaagaggaagcgaaagaatatgttaagagttttgcagggcaagttggtgaagtaacggta
aatggttacatgcctgtagagcttgttgcgagcggtgagtatatgatcggcatcaatttc
atgggagatcaaagaatgcttcaaaaacaaggctttccagttgtaagtatcgtacctgag
caaacagggttatctgttaatgcgatttcgaaactaaaacgtgcaccgaatggtattatt
gcggatttatttattgattattgtttatcagaagaagcgggtcacattttagaaaaggtt
tcgtttggcgtgccaacgatgtttgcgaagaacgagaaagaaatagaaggacagccggtt
agaagaacaaaccaaaatatatcaaatagcggaataatcgagatatggaatagacaacgt
ctctctcagaagtga

DBGET integrated database retrieval system