KEGG   Bacillus thuringiensis Al Hakam: BALH_1126Help
Entry
BALH_1126         CDS       T00429                                 

Definition
(GenBank) ABC transporter, ATP-binding protein, possible sodium exporter
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
btl  Bacillus thuringiensis Al Hakam
Brite
KEGG Orthology (KO) [BR:btl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btl02000]
    BALH_1126
Transporters [BR:btl02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BALH_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 SbcCD_C SMC_N AAA_23 Polysacc_deac_2
Motif
Other DBs
NCBI-ProteinID: ABK84482
UniProt: A0RB89
LinkDB All DBs
Position
1278607..1279515
Genome map
AA seq 302 aa AA seqDB search
MWIMSLLIKDLTKKFDEHVAVNNLNIEIPKGEIFGFLGGNGAGKTTTFRMILGLLSKSSG
TISWNGKPINYGVTDKIGYLPEERGLYAKMTVKEQVNFFAKLKNMKSKDAEKELHYWLER
FNITEHLNKKVGELSKGNQQKIQLITAIIHKPELLILDEPFSGLDPVNVEMLKDAVLDMQ
KQGSSILFSSHRMEHVEELCQHICIMHKGVPVVQGDIAKIKSDFGKKNVVIVGDHDFDHL
KEIKGVESMKKRKNAVTLKISYEEVSHVLFKEITKLGYVKKFAVEEPTLNDIFIAKVGAQ
NE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtggataatgagtttactaattaaagatttaacaaagaaatttgacgagcatgttgca
gtgaataatttgaatatcgagataccaaaaggtgaaatatttggattcttgggcgggaat
ggagcaggtaaaacgactacatttcgaatgatacttggactattatcgaaatcaagtggg
accatttcatggaatggtaaacctataaattatggtgttacagataaaattgggtattta
ccagaagaacgtggtctttatgcgaaaatgactgtcaaagaacaagttaatttttttgca
aaactaaagaacatgaaaagtaaagatgcagaaaaagaacttcactattggctggagcgt
tttaatattactgagcatctgaacaaaaaggtaggagaactttctaaagggaatcagcaa
aaaatccagttgataacagcgattatacataagcctgaactcttaattttagatgaacca
tttagtggtttagacccagtaaatgttgaaatgttaaaagacgctgttcttgatatgcaa
aaacaagggtcgtcaattctttttagttcacatcgtatggaacatgtggaagagttatgc
caacacatttgtattatgcacaaaggtgtacctgttgttcagggtgacattgccaaaatt
aaaagtgattttggtaaaaagaacgttgtaatcgttggcgatcatgactttgaccatttg
aaagaaataaaaggtgtagaaagtatgaaaaaacgtaaaaatgcagttactcttaaaatt
tcatatgaagaagtttcacatgttttatttaaagagataacaaaattaggatatgttaaa
aagtttgcagtagaagagcctacattaaatgatatctttattgcgaaagtaggtgcacaa
aatgagtag

DBGET integrated database retrieval system