KEGG   Bacillus thuringiensis Al Hakam: BALH_1850Help
Entry
BALH_1850         CDS       T00429                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00473  D-Alanine metabolism
btl01100  Metabolic pathways
btl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BALH_1850
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BALH_1850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btl01011]
    BALH_1850
Enzymes [BR:btl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BALH_1850
Peptidoglycan biosynthesis and degradation proteins [BR:btl01011]
 Precursor biosynthesis
  Racemase
   BALH_1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF4170
Motif
Other DBs
NCBI-ProteinID: ABK85169
UniProt: A0RD76
LinkDB All DBs
Position
2000124..2001350
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNAIIELGVRPMSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKAN
GYGHGAVEVAKAAIEAGINQLAIAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDV
MMTVYRSEDLQGINEIANRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVV
GMFTHYSTADEIDKSYTNMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMELSNTFQNMV
RVGIGIYGMYPSKEVNHSVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGHALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQG
EENIAVEEIADMLGTINYEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgaaatagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacataatgtaaaa
gaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgtaaaagcgaat
gggtatggtcatggggcagttgaagttgcaaaagctgctattgaagcaggaataaatcag
cttgcaattgcatttgtagatgaagcgatagagttaagagaagcaggaattaacgtgccg
attttaattttaggctatacatcagtagcggctgcggaagaagcaattcaatatgacgtt
atgatgaccgtttatagaagtgaagatttacaaggtataaatgaaatcgcaaaccgtctt
caaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcattggtttacag
gaagaagaggttaaaccatttttagaggaattaaaacgtatggagtatgtagaggtagtg
ggaatgtttacacattactctacggcagatgaaatcgataaatcatatacgaatatgcaa
acaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcatattccatat
attcatagttcaaatagtgcaggttcaatggaacttagcaatacatttcaaaatatggtt
cgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtaaatcattcagttgtt
tcgttacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcatgcgaagaaa
aatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatggattgccact
gtaccgattggttatgctgatggttataatcgtcagttatctaataaagggcatgcatta
ataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctcatgttagac
gtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggtaaacaaggc
gaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaactatgaagtt
acatgtatgttagatagaagaattccacgtgtgtataaagaaaataatgaaacaactgct
gttgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system