KEGG   Bacillus thuringiensis Al Hakam: BALH_3493Help
Entry
BALH_3493         CDS       T00429                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Brite
KEGG Orthology (KO) [BR:btl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:btl01001]
    BALH_3493
Enzymes [BR:btl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BALH_3493
Protein kinases [BR:btl01001]
 Serine/threonine kinases: Other
  Bacterial family
   BALH_3493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kinase-like Haspin_kinase Kdo ETRAMP Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ABK86728
UniProt: A0RHN5
LinkDB All DBs
Position
complement(3706903..3708888)
Genome map
AA seq 661 aa AA seqDB search
MKCNVLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRF
HREAQSVTTLSHPNIVNMYDVGEEDGIYYLVMEYVPGQTLKQYIIERGMLPIGEALDIME
QLTSAMAHAHHFEIVHRDIKPHNILIRADGVIKVTDFGIATATSATTITHTNSVLGSVHY
LSPEQARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPKRWNEN
IPQSVENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPII
QQEQLFENVTDETIVLKGSKVDEQIRKEETDLSKKKKRSNKWLKILITTFLLLAIGITLA
LTVIPGFFIPKDVKVPDVAGMKYTTAVNTLVEKGFEVTEPNIVYTDDVETGDVIKTDPVA
GRVVKENSKITIYQSGGKKKSKMIDFTGKDLESIRTELEEKYKQVTVYYIEDDRPKGAIV
EQIPTSDQMVVEAEQELKIWVSKGPYQIRPGDFSRWTENSVTGYLNERKLTPDIKREYSD
TVDKGLVISQSPKPGTPLKEGDKVTIIISEGPKPKVTKTVKVDNISIPYESSIIGEKKPQ
TIEIYKEDMQQKMDRPIETRTISESATISLEFVIQEDTKGRYKIVRDGVTIIDKEVPYPT
Q
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtgcaacgtgctgattggaaaacgcttaaatgaccgttataagctgctgaaaatg
attggtggcggtggaatggccaatgtgtatttagctcatgatgatatactgggccgggat
gtagcggtgaaaatattaagactcgactattcaaataacgaagagtttattaaacgtttc
catcgagaagcgcagtctgttacaacgttgtcgcatccaaatattgtgaatatgtatgat
gtcggagaagaggatggtatatattatcttgtaatggagtatgtaccaggacaaacattg
aagcaatacataattgagcgagggatgttacctattggagaagctcttgacataatggag
cagttaacatccgccatggcacacgcccatcattttgaaattgtgcaccgtgatattaaa
ccgcacaatattttaattcgagctgatggagtaataaaagtaacagattttggaattgcg
acagctacaagtgcaacaacaattacacatacaaattcagtactcggttcggtgcattat
ttatcaccagaacaagcacgcggtgggatagcaaataaacaatcagatatttattcccta
gggatcgttatgtttgagttgttaacaggaagacaaccgttttctggcgaatctgctgtt
gctatagctttaaaacatttacaaagtgaaattccatctccaaaaagatggaatgaaaat
attcctcaaagtgtcgaaaatattatattaaaggcaactgcgaaagatccatttcatcga
tatcaatctgccaatgcgatgaaacgagatattgaaactgcgctatatccagagaggata
aatgagcagccattttacataccggaagatatggaagcgacaaaagcgattccgattatt
caacaagaacaattattcgaaaatgttactgatgaaacaattgttttaaaaggaagtaaa
gtggatgaacagataagaaaagaagaaacggatttaagtaagaagaaaaaacgaagtaat
aaatggctcaaaattttaattacaacatttttactgttagcgattggaataacgttagcg
cttactgttattccaggattctttattccaaaagatgtaaaagtacctgatgtggctggt
atgaaatatacgacagcagtaaatacattagttgaaaagggttttgaagttacggaacct
aatattgtatatacagatgatgttgaaaccggtgacgttataaaaacagatcctgtagca
ggtagagtcgtgaaagaaaattctaaaattactatctatcaatcaggtgggaaaaagaaa
agtaagatgattgatttcacaggaaaagatttagagagtataagaacagagttagaagag
aaatataaacaagttacagtatattatattgaagatgataggccgaaaggtgcaattgta
gagcaaattccgacgtctgaccaaatggtggtagaggccgagcaagaactgaaaatctgg
gtaagtaaaggcccttatcaaattagaccgggtgatttttcaaggtggactgaaaatagt
gtaactggttatttgaatgagagaaaactaactccagatataaaacgagagtattccgat
actgttgataaaggacttgtaatttcgcaatctccaaaaccgggaacgccgttaaaagaa
ggggataaagtgacgattatcatctcagagggccctaagccgaaagtaacgaaaaccgtg
aaagtggataatatttctattccgtatgagtcttctataataggtgagaaaaaaccgcaa
acaatagaaatttataaagaagatatgcaacaaaaaatggatagaccaattgaaactaga
acaatttcagagtcggcaactatttcattagaatttgtaattcaagaagatacaaaagga
cgctataaaattgtaagagatggtgtaacgattattgacaaagaagtaccatatccaaca
caataa

DBGET integrated database retrieval system