KEGG   Bacillus thuringiensis Al Hakam: BALH_4177Help
Entry
BALH_4177         CDS       T00429                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00020  Citrate cycle (TCA cycle)
btl00480  Glutathione metabolism
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01120  Microbial metabolism in diverse environments
btl01130  Biosynthesis of antibiotics
btl01200  Carbon metabolism
btl01210  2-Oxocarboxylic acid metabolism
btl01230  Biosynthesis of amino acids
Module
btl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BALH_4177 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BALH_4177 (citC)
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BALH_4177 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABK87384
UniProt: A0RJJ1
LinkDB All DBs
Position
complement(4397458..4398765)
Genome map
AA seq 435 aa AA seqDB search
MGVITLTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKK
IVWKEVLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDL
YVCLRPVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMG
VNKIRFPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNW
GYEVAEQEFGDKVFTWAEYDRIVEKDGKEAANKAMADAEVAGKIIVKDSIADIFLQQILT
RPREFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLD
KVNPSSVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFA
NELIKNMDVAIIKNA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggggttatcacattgacgacaggtgaaaaaattactgtaactaatggtgttatgaat
gtaccaaacaatccgattattccatttatcgaaggagatggaattggtcctgatatttgg
gcagctgcatctcgtgtactagaagcagcagttgaaaaagcttatgatggtgagaagaaa
atcgtttggaaagaagtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggtta
ccagaagaaactttaaatttaattcgtgaatatttaatcgcgattaaaggtccacttaca
actccagttggcggtggtattcgttctctaaacgtagcacttcgtcaagaattagattta
tatgtatgtctacgtccagttcgttattttgaaggtgttccttcacctgtaaaacgtccg
gaagatactgatatggttattttccgtgaaaatacagaagacatttatgctggaattgaa
tatgcgcaaggatctccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggt
gttaataaaatccgcttcccagaaacatctggtattggtattaaaccaatctcagaagaa
gggacaaagcgtcttgttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttct
gttacattagttcataaaggaaacattatgaaatttacagaaggtgctttcaaaaactgg
ggttacgaagtagcggaacaagaattcggcgacaaagtatttacttgggctgaatatgat
cgcatcgttgagaaagatggtaaagaggcagcgaataaagcgatggcagacgctgaagtg
gctggaaaaatcatcgtaaaagattctattgcagacatcttcttacaacaaattttaact
cgtccacgtgagttcgatgttgttgcaacaatgaacttaaacggagactacatctctgat
gcacttgctgcacaagtaggtggaattggtattgcacctggtgcaaacattaactatgtg
actggacatgctatctttgaagctacgcacggtacagctccaaaatatgcaggtttagat
aaagtaaacccatcttcagttcttctttctggtgtattattattagagcacttaggatgg
aacgaagctgcgaaattagtaactgcttcagttgagaaaacaattgcttcaaaagtagta
acttatgatttcgcacgcttaatggaaggtgcaacagaagtgaaatgttctgagttcgct
aatgaacttattaaaaacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system