KEGG   Bacillus thuringiensis Al Hakam: BALH_4448Help
Entry
BALH_4448         CDS       T00429                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Brite
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BALH_4448 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABK87645
UniProt: A0RKA2
LinkDB All DBs
Position
complement(4683860..4684456)
Genome map
AA seq 198 aa AA seqDB search
MFPSMLGQSKGRMYFGGNEMKKRLFFSCCLLFLMAGCDQGKPKEIDVKLHNASGDEVGTA
KVTQQTSGVKITIKGEGFAPGPHGLHVHEIGECKAPRFESAGNHFNPDDKKHGLLNPKGA
ENGDLPNVIADGSGKIKAEIDAPHITLEEGKTTIHRKDGASIIITENADDGMTQPTGKSG
DRIACGVIVKKASDMKKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtttccctctatgctcggacaatctaagggcagaatgtattttggagggaatgaaatg
aaaaaacggctttttttcagttgttgtttactatttctgatggcaggttgtgaccaagga
aagccgaaagaaattgacgtgaaattacataatgcttcaggtgatgaagtggggactgcg
aaagtaactcagcaaacaagcggagtgaaaattacgattaaaggggaaggtttcgcgcca
ggcccgcacggactacatgtacacgaaattggagagtgtaaagcacctcgttttgaatca
gctggaaatcattttaatccagatgataaaaagcatggactactcaatccgaagggtgca
gaaaacggtgatttaccgaacgtaattgcagacggttctgggaaaattaaagcagaaatc
gatgcaccgcatataacgcttgaagaaggaaaaacgacgattcatagaaaagatggagcg
tctattattattacagaaaacgctgatgatggtatgacacaaccgacaggtaaatcaggt
gatcgaattgcttgtggtgtcattgtaaaaaaagcgtcggatatgaagaaaaagtaa

DBGET integrated database retrieval system