KEGG   Bacillus thuringiensis Al Hakam: BALH_4829Help
Entry
BALH_4829         CDS       T00429                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00240  Pyrimidine metabolism
btl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BALH_4829 (tdk)
Enzymes [BR:btl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BALH_4829 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 UvrD-helicase DZR zf-C4_ClpX
Motif
Other DBs
NCBI-ProteinID: ABK88009
UniProt: A0RLB6
LinkDB All DBs
Position
complement(5086454..5087041)
Genome map
AA seq 195 aa AA seqDB search
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFEHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTNKDK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaataaatcagaacggttggattgaagtgatttgcggtagtatgttttctggt
aaatcagaagagcttatccgccgtgtgcgtcgtacgcaatttgcgaaacaacatgcaatt
gtatttaaaccatgtattgataatcgctatagtgaagaagacgttgtatcacataacgga
ttaaaggtaaaagcagttcctgtttcagcttcaaaagatatatttgaacatatcactgaa
gaaatggatgtaattgcaattgatgaagtgcaattctttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggtttagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaacaaaa
ctacaagctgtatgttctgcatgtggatctccggcaagtcgtacacaacgattaattgat
ggagaaccagcggcatttgatgatccaattattttagttggggcttcagaatcgtatgaa
ccacgctgtcgtcattgtcatgcagttcctacaaacaaagataagtaa

DBGET integrated database retrieval system