KEGG   Bacillus thuringiensis MC28: MC28_0354Help
Entry
MC28_0354         CDS       T02263                                 

Definition
(GenBank) ComK
  KO
K02250  competence protein ComK
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:btm00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MC28_0354
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:btm03000]
    MC28_0354
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:btm02044]
    MC28_0354
Transcription factors [BR:btm03000]
 Prokaryotic Type
  Other transcription factors
   Others
    MC28_0354
Secretion system [BR:btm02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   MC28_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: AFU11776
UniProt: K0FJ08
LinkDB All DBs
Position
340315..340896
Genome map
AA seq 193 aa AA seqDB search
MESKVERYVENYVVTKNTMALLPVILSEKKIVTRVVEMEDSFFVFQKPLDIIERSCRKHG
SSFLGRKEGTKELTHITHKAPIAISPTDQLYFFPTYSYSRKECAWLSHFYIESNRELKDG
NLMIRFINGLAVKLEISKSSFENQQNRTAKLRTEYEDRKKKQGNPCFKEIDKRDESTLRP
AYEKVYFVREEDV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtagaacgctatgtcgaaaattatgttgtaactaaaaatacaatggcc
ttacttcctgttattctaagtgaaaagaaaattgttacgcgagttgttgaaatggaagat
tcttttttcgtatttcaaaagcctctagatattatagagagaagttgtcgtaagcatgga
tctagttttttgggcagaaaagaaggaacgaaagagttaacgcacattacacataaagca
ccgattgcaatcagtccgacagatcaactttattttttccctacttattcttattctaga
aaagagtgcgcgtggctgtcgcatttttatatcgaaagtaatcgagaattaaaagatgga
aatcttatgattcgatttataaatggccttgctgtgaaattagaaatatcaaaaagtagt
tttgaaaatcaacaaaatcgtacagcgaaactgcgtacagaatatgaagatcgaaagaag
aaacaaggaaatccttgttttaaagaaattgataaaagagatgaatcaacattaagacca
gcttatgagaaagtgtattttgttagggaagaagatgtgtga

DBGET integrated database retrieval system