KEGG   Bacillus thuringiensis MC28: MC28_1291Help
Entry
MC28_1291         CDS       T02263                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00473  D-Alanine metabolism
btm01100  Metabolic pathways
btm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MC28_1291
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MC28_1291
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btm01011]
    MC28_1291
Enzymes [BR:btm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MC28_1291
Peptidoglycan biosynthesis and degradation proteins [BR:btm01011]
 Precursor biosynthesis
  Racemase
   MC28_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Urease_linker
Motif
Other DBs
NCBI-ProteinID: AFU12713
UniProt: K0FL06
LinkDB All DBs
Position
1247647..1248873
Genome map
AA seq 408 aa AA seqDB search
MKREIEWNAIIELGVRPMSLKYGRDTIVEVDLNAVKHNVKEFKKHVNDENIAMMAAVKAN
GYGHGAVEVAKAAIEAGVNQLAVAFVDEAIELREAGITVPILILGYTSVAAAESAIQYDV
MMTVYRIEDLQGINEIAQRLQNKARIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVV
GMFTHYSTADEIDKSYTNMQTSLFEKAVNTANELGMQIPYIHSSNSAGSMELSNTFQNMV
RVGIGVYGMYPSKEVDHTVVSLQPALSLKSKVAHVKHATKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGYALINGVRVPVIGRVCMDQLMLDVTKAMPVQVGDDVVFYGKQG
EEEIAVEEVADMLGTINYEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaatagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgttgaagttgacttaaatgctgtaaaacataatgtaaaa
gaatttaaaaaacatgtaaacgatgaaaatattgcaatgatggctgctgtaaaagcgaat
gggtatggccatggggcagttgaagttgcgaaagctgcgattgaagcaggggtgaaccag
cttgcagttgcatttgtcgatgaagcgatcgaattaagagaagctggaatcactgtacca
atcttaatattgggttatacatcagttgcagctgcggaatccgcaattcaatatgatgtt
atgatgacagtctatagaatagaagatttacaaggcataaatgaaattgcacaacgtctt
caaaataaagcacgtattcaagtgaaaatcgatacaggaatgagccgtatcggtttgcaa
gaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatgtagaggtagta
gggatgtttacacattactctacggcagatgaaattgataaatcgtatacgaatatgcaa
acaagtttatttgagaaagctgtaaatacagcaaatgaattagggatgcaaataccatac
attcatagttcaaatagtgcagggtcaatggaactaagcaatacatttcaaaatatggtt
cgcgttggtattggagtttacggcatgtatccttcgaaagaagtggatcatacagtcgtt
tccttacagcctgcattgtcattaaaatcaaaagtagctcatgttaaacatgcgacgaaa
aatcgtggtgttagttatggaaatacgtatgtaacaacgggtgaagaatggattgcgact
gtgccgattggttatgctgatggctataatcgccagttatctaataaagggtatgcatta
attaatggagttcgagtgccggttattggtcgtgtttgtatggatcagcttatgctggac
gttacaaaagcgatgccagtacaagtaggggacgatgtggtattttacggcaaacaaggt
gaagaagaaattgctgtagaagaagtagcggatatgttaggcacaattaattatgaagtt
acatgtatgttagacagaagaattcctcgtgtttataaagaaaataatgaaacgactgcg
gttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system