KEGG   Bacillus thuringiensis MC28: MC28_3085Help
Entry
MC28_3085         CDS       T02263                                 

Gene name
prkC
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
btm  Bacillus thuringiensis MC28
Brite
KEGG Orthology (KO) [BR:btm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:btm01001]
    MC28_3085 (prkC)
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MC28_3085 (prkC)
Protein kinases [BR:btm01001]
 Serine/threonine kinases: Other
  Bacterial family
   MC28_3085 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Haspin_kinase Kinase-like Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AFU14507
UniProt: K0FJE2
LinkDB All DBs
Position
complement(3035553..3037481)
Genome map
AA seq 642 aa AA seqDB search
MIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREAQSVTTLSHPNIVNMY
DVGEEDGIYYLVMEYVPGQTLKQYIIEQGMLPIGEALDIMEQLTSAMAHAHHFEIVHRDI
KPHNILIRADGVVKVTDFGIATATSATTITHTNSVLGSVHYLSPEQARGGIANKQSDIYS
LGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPRRWNENIPQSVENIILKATAKDPFH
RYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQLFENVTDETIVLSGS
KVDEPKRKEHTELDKKKKRSNKWIKVLITTFLLLAIGITLALTVIPGFFIPKDVKVPDVA
GMKYTTAVNKLVEKGFEVTEPNIVYTDDVEAGDVIKTDPVAGRVVKESSKITIYQSGGKK
KSKMKDFTGQNFESVKPELEERYKQVTENYIENDKPKGEIVEQIPTPDQMVVEAEQELKV
WISKGPYQNRPGDFSRWTENSATGDLNERKLTPDIKREYSDTVDKGLVISQSPKPGTPLK
EGDKVTLIISNGPKPKVTKTVKVDNISIPYESSIIGEKKPQTIEIYKEDMQQKMDRPIET
RTISESATISLEFVIQEGSKGHYKIVRDGVTIIDKEVPYPTQ
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgattggcggtggagggatggccaatgtatatttagctcatgatgacatactcggccga
gatgtagcggtgaaaatattaagactcgactattccaataacgaagagtttattaaacgt
ttccatcgagaagcgcaatctgttacaacgttgtcgcatccaaatattgtgaatatgtat
gatgttggagaagaagatggtatatattatcttgtaatggagtatgtacctggacaaaca
ttaaagcaatacataattgagcaagggatgttacctataggggaagctcttgatattatg
gagcaattaacatccgccatggcacacgctcatcattttgaaattgtgcatcgtgatata
aaaccgcacaatattttaattcgagctgatggagtagtaaaagtaacagattttggaatt
gcgacagctacaagtgcaacaactattacacatacaaattcagtacttggttcggtgcat
tatttatcaccagaacaagcgcgcggcgggatagcaaataaacaatcagatatttattcg
cttggtattgttatgttcgaattgttaacaggaagacaaccgttttctggtgaatctgct
gttgcaatagctttaaaacatttacaaagtgaaataccgtctccaagaagatggaatgaa
aatattccgcaaagtgttgagaatattatattaaaggcaactgctaaagatccgttccat
cgataccaatctgctaatgcgatgaaacgagatattgaaacggctttatatccagaacga
attaatgaacagccattttacataccagaagatatggaagcgacgaaagcgattccaatt
atccaacaagaacaattatttgaaaatgtaactgatgaaacgattgttttaagtggaagt
aaagtggatgaaccaaaaagaaaagaacatactgaattagataagaagaaaaaacgaagt
aataaatggattaaggttttaattacgacatttttacttttagcaattggaataacatta
gctcttactgttattccgggattctttattccgaaagatgtaaaagttcctgatgtggct
ggtatgaaatatacgacagctgtaaataaattagtagaaaaaggttttgaagtgacagaa
cctaatattgtatatacagatgatgtggaagctggagatgtaataaaaactgatcctgta
gcaggaagagtagtgaaggaaagttctaaaattactatctatcaatcaggtggaaaaaag
aaaagtaagatgaaggattttacaggtcaaaactttgagagtgtaaaacccgagttagaa
gaaagatataaacaggttactgaaaattatattgaaaatgataaaccaaaaggtgaaatt
gtagaacaaataccgacacctgatcaaatggttgtagaggcggagcaagaactgaaagtt
tggataagtaaaggtccttatcaaaatagaccaggtgatttttcaagatggactgaaaat
agtgcaactggtgatttgaatgagagaaaattaactccagatataaaacgagagtattca
gatacggttgataaaggtcttgtaatttcgcaatcgccaaaaccaggaactccgttaaaa
gaaggagataaagtgacacttatcatctcgaatggccctaagccgaaagtaacaaaaaca
gtgaaggtggataacatttctatcccatatgagtcttctataataggtgagaaaaaaccg
caaacaatagaaatttataaagaagatatgcaacaaaagatggatagaccaattgaaact
agaacgatttcagagtcggcaacaatttctttagaatttgtaattcaagaaggctcaaag
ggtcactataaaatcgtacgggatggagtaacgattatcgataaggaagtaccatatcca
actcaataa

DBGET integrated database retrieval system