KEGG   Bacillus thuringiensis MC28: MC28_3526Help
Entry
MC28_3526         CDS       T02263                                 

Definition
(GenBank) hypothetical protein
Organism
btm  Bacillus thuringiensis MC28
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqzE
Motif
Other DBs
NCBI-ProteinID: AFU14948
UniProt: K0FSI0
LinkDB All DBs
Position
complement(3425479..3425628)
Genome map
AA seq 49 aa AA seqDB search
MDAPKEDRKQKKEQRRSEKEPFLNKWFGVMPLSAALFYRNVKNKRKKSS
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaccaaaagaagatcgtaaacaaaagaaagaacaacgccgctctgaaaaagag
ccatttttaaataaatggtttggtgttatgccgcttagtgcagctttattttatcgaaac
gtaaaaaataaaaggaaaaaatcaagttaa

DBGET integrated database retrieval system