KEGG   Bacillus thuringiensis MC28: MC28_3794Help
Entry
MC28_3794         CDS       T02263                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00020  Citrate cycle (TCA cycle)
btm00190  Oxidative phosphorylation
btm00650  Butanoate metabolism
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01120  Microbial metabolism in diverse environments
btm01130  Biosynthesis of antibiotics
btm01200  Carbon metabolism
Module
btm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC28_3794 (sdhB)
   00650 Butanoate metabolism
    MC28_3794 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MC28_3794 (sdhB)
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MC28_3794 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     MC28_3794 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AFU15216
UniProt: K0FT81
LinkDB All DBs
Position
complement(3678860..3679621)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQEFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNQTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFMGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagatggaccagatgcacaagag
tttgaccaagagtttgaaattccatatcgtccaaatatgaatattatttcggcacttatg
gaaattcgccgtaatcctgttgattcaaaagggaaccaaacaactccgattgcatgggat
atgaactgtttagaggaagtatgtggcgcttgctcgatggttattaacggaaaaccacgt
caatcatgtacagcgcttattgatcaattagaacagccaattcgcttaaaaccgatgaag
acattcccggttgtacgtgatttacaagttgaccgtagtcgtatgtttaacgcattaaaa
cgcgttaaggcttggattccaatcgatggtacgtatgacctaggtccaggaccaagaatg
ccggagaagaaacgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaacagtaaatctgactttatgggaccagcaccgttatca
caagctcgtttattcaactcgcatccaacaggtgaaatgcacaaagcagatcgcttacgt
gcaattatgggagatggagggcttgcaaactgtggtaactctcaaaactgtgtgcaatca
tgtccgaaaggtattccattaacaacttcaatcgcagcattaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgataataactattaa

DBGET integrated database retrieval system