KEGG   Bacillus thuringiensis MC28: MC28_3795Help
Entry
MC28_3795         CDS       T02263                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00020  Citrate cycle (TCA cycle)
btm00190  Oxidative phosphorylation
btm00650  Butanoate metabolism
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01120  Microbial metabolism in diverse environments
btm01130  Biosynthesis of antibiotics
btm01200  Carbon metabolism
Module
btm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC28_3795 (sdhA)
   00650 Butanoate metabolism
    MC28_3795 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MC28_3795 (sdhA)
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MC28_3795 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MC28_3795 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 Not3
Motif
Other DBs
NCBI-ProteinID: AFU15217
UniProt: K0FLI1
LinkDB All DBs
Position
complement(3679614..3681407)
Genome map
AA seq 597 aa AA seqDB search
MKGKLIVVGGGLAGLMATIKAAEAGVNVELFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTEEGLLDFRRFGGTQH
HRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWDFLRAVVDDEGVCRGIVAQDLQT
MEIKSFQADAVIMATGGPGIIFGKSTNSIINTGTAASAVYQQGAYYANGEFIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVEQKL
GINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFTGDDPRKLPMKIFPAVHYSMGGLWVD
YKQMTSIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAIEYMKGLSKSSDAVS
SSVYEQNELIETEKFNNILTLDGNENAYVLHKELGEWMTDNVTVVRENKKLLETDAKIEE
LMARYKRININDTARWSNQGASFTRQLANMFELARVITIGAYNRNESRGAHYKPEFPNRD
DANFLKTTMAKFEGEGNAPAFHYEEVDVSLIKPRKRDYSSKHDVAAKGEEKGDKQHV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaaacttatagtagtcggcggtggcttggctggcttaatggcaacgattaaa
gcggcagaagcaggagtaaatgttgaactgttttcattagtaccagtaaaacgttcacat
tctgtatgtgctcagggcggaattaacggtgccgtaaatacgaaaggtgaaggggattct
ccatggatccactttgacgatacaatttatggtggggatttcttagcgaaccaaccacca
gttaaagcaatgtgtgaagcagcacctggtattattcatttaatggaccgtatgggtgtt
atgttcaaccgtacggaagaaggacttcttgatttccgtcgttttggtggaacacaacat
caccgtacagcatttgctggtgcaacaactggacagcaattactatacgcattagatgag
caagtacgtcgtcacgaagtagcaggacttgtaacgaaatatgaaggttgggatttctta
cgagctgttgttgatgatgaaggtgtgtgccgaggaatcgttgcacaagacttacaaact
atggagattaaaagtttccaagctgatgccgtgattatggcaacagggggccctggtatc
atctttggaaaatcaactaactctattatcaatacaggtacagcagcgtctgctgtatat
caacaaggtgcatattatgcgaacggtgagtttattcaaatccatccaacggcaattcct
ggagacgataagttacgtcttatgagtgaatctgcgcgtggtgaaggtgggcgtgtttgg
acatataaagatggtaagccatggtacttcttagaagagaaatatcctgcttacggaaac
cttgtacctcgtgatattgcaacgcgtgaaatctttgatgtttgcgtagagcaaaaacta
ggtattaacggtgaaaacatggtgtacctagatctttctcataaagatccgaaagaacta
gatattaaacttggtggaattattgaaatctatgagaagtttacaggagatgatcctcgt
aaactaccaatgaaaatcttcccagcggttcactattcaatgggcgggctatgggttgat
tataagcaaatgacaagcattccaggtttatttgcagcaggtgagtgcgattattctatg
cacggtggtaaccgccttggtgcgaattcactattatcagcaatttacggtggtatggta
gcaggaccgaacgcaattgagtatatgaaaggtctttctaaatcatctgatgctgtttca
tctagtgtatatgagcaaaatgaattaatcgaaacagagaaatttaacaatattttaacg
cttgatggtaacgaaaatgcatatgttcttcacaaagagttgggagaatggatgacagat
aacgttacagtagttcgtgaaaataaaaagttattagaaacagatgcaaaaattgaagag
ttaatggcgcgttacaaacgcattaacattaacgatacagcaagatggagtaaccagggt
gcttcatttacacgtcaacttgcaaatatgtttgagctagctcgtgttattacaattggg
gcatataaccgtaatgaaagccgcggagcgcattacaaaccggaattcccaaatcgtgat
gatgcaaacttcttaaaaactacaatggcaaaatttgagggagaaggaaatgcaccagca
ttccattacgaagaagtggatgtttcattaattaaaccacgtaaacgtgactattcttca
aaacatgatgtagctgctaagggtgaagagaagggggataagcaacatgtctga

DBGET integrated database retrieval system