KEGG   Bacillus thuringiensis MC28: MC28_3871Help
Entry
MC28_3871         CDS       T02263                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00020  Citrate cycle (TCA cycle)
btm00480  Glutathione metabolism
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01120  Microbial metabolism in diverse environments
btm01130  Biosynthesis of antibiotics
btm01200  Carbon metabolism
btm01210  2-Oxocarboxylic acid metabolism
btm01230  Biosynthesis of amino acids
Module
btm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:btm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC28_3871 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MC28_3871 (icd)
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MC28_3871 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFU15293
UniProt: K0FTI2
LinkDB All DBs
Position
complement(3759482..3760789)
Genome map
AA seq 435 aa AA seqDB search
MGVITLTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWEAASRVLEAAVEKAYDGEKK
IVWKEVLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDL
YVCLRPVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMG
VNKIRFPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNW
GYEVAEQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILT
RPREFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLD
KVNPSSVLLSGVLLLEHLGWNEAAKLVTDSVEKTIASKVVTYDFARLMEGATEVKCSEFA
NELIKNMDVAIIKNA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggggttatcacattgacgacaggtgaaaaaattactgtaactaatggtgttatgaat
gtaccaaacaatccgattattccatttatcgaaggagatggaattggtcctgatatttgg
gaagctgcatctcgcgtactagaagcagcagtagaaaaagcttatgatggtgagaagaaa
atcgtttggaaagaagtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggtta
ccagaagagactttaaatttaatccgtgaatatttaatcgcaattaaaggtccacttaca
actccagttggcggtggtattcgttctctaaacgtagcgcttcgtcaagaattagattta
tacgtatgtctacgtccagttcgttattttgaaggtgttccttcacctgtaaaacgtccg
gaagatactgatatggttattttccgtgaaaatacagaagacatttatgctggaattgaa
tatgcacaaggatctccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggt
gttaataaaatccgcttcccagaaacatctggtattggtattaaaccaatttcagaagaa
gggacaaagcgtcttgttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttct
gttacattagttcataaaggaaacattatgaaatttacagaaggtgctttcaaaaactgg
ggttatgaagttgcggaacaagaatttggcgataaagtatttacttgggctgaatatgat
cgcatcgttgaaaaagatggcaaagatgcagcgaataaagcgatggcagacgcagaagtg
gctggaaaaatcatcgtaaaagattctattgcagatatcttcttacaacaaatattaact
cgtccacgtgagttcgatgttgttgcaacaatgaacttaaatggtgactatatctctgat
gcacttgctgcacaagtaggtggaattggtattgcacctggtgcaaacattaactatgtg
actggacatgctatctttgaagctacacatggtacagctccaaaatatgcaggtttagac
aaagtaaacccatcttctgttcttctttctggtgtactattactagaacatttaggatgg
aatgaagctgcgaaattagtaactgattcagttgagaaaacaattgcatcaaaagtagta
acatacgacttcgctcgtctaatggaaggcgcaacagaagtgaaatgttctgaatttgct
aatgagcttattaaaaacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system