KEGG   Bacillus thuringiensis MC28: MC28_4622Help
Entry
MC28_4622         CDS       T02263                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
btm  Bacillus thuringiensis MC28
Brite
Enzymes [BR:btm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MC28_4622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase NDUFB11
Motif
Other DBs
NCBI-ProteinID: AFU16044
UniProt: K0FXA1
LinkDB All DBs
Position
4493339..4494610
Genome map
AA seq 423 aa AA seqDB search
MKKILSILLLLVLSISSLGVTTSHAEEKIHIEAAAALLFDADTGKILHEQNPDELLAIAS
MSKLIVVYAVLEAIKEGKITWDTKVNISDYAYEVSRNNEFSNVPFEKGRQYTVKELYHSI
VIFSANGSSIALAELLAGSEKNFLNLANDHAKKLGLKKYKFVNATGLNNADLKGKHPEGT
DPNGENSMSARDMGILSKTIITKYPEMLEDTKQRFRNFPDNHPKPIRMENWNWMLPGAAF
AYEGSDGLKTGSSDTAGYGFTITAKRGDLRLISVIIKTKSMDERFTESRALIEYGFNSFE
KQKLKIDKNNTISVVKGKADQVTVAPEKEITVIAKKGDKSPYKISTEADKSLAEDGHLIA
PIKKDTKVGSIVLESTDKYGFLDGNKSMKVAAKTTEEVEKANWFVLTMRSVGDFFSNLWS
KIF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcttgtctattttactattgcttgtattgtcaatttcttccttaggagta
acaacatcccatgcggaagaaaaaatacatattgaggcagccgctgcacttctatttgat
gcagatacaggaaaaatactgcatgagcaaaatccagatgaattactagctatcgctagt
atgtcaaaattaattgttgtttatgctgttttagaggcaattaaagaagggaaaattact
tgggatacaaaagtaaatatttctgattatgcttatgaagtctctcgtaataacgaattc
tctaacgtaccgtttgaaaaaggacgtcaatatactgtaaaagaattatatcattctatc
gttatcttctctgcgaatggatctagtattgctttagcagaacttcttgcaggaagcgaa
aaaaacttcttaaatcttgcaaatgaccatgcaaaaaaactagggttaaagaaatataaa
tttgtaaacgctactgggttaaataacgctgatttaaaagggaaacatcctgaaggaact
gatccgaatggagaaaactccatgtcagctcgcgatatgggtattctttcaaaaacaatt
attacaaagtatccagaaatgctagaggatacaaaacaaagatttagaaacttcccggat
aatcatccgaagccaattcgtatggaaaactggaactggatgttaccaggtgctgctttc
gcttatgaagggtcagatggtttgaaaacaggaagttctgatacggctggatatggattc
actattacagcaaaacgtggtgatttacgtcttatttccgttattattaagacaaaatca
atggacgaacgtttcacagaatctcgtgcattaattgaatatggatttaatagcttcgaa
aaacaaaagctgaaaattgataaaaataatacaatctctgtagtaaaagggaaagcagat
caagtaactgttgcacctgaaaaagaaataacagtaattgcgaaaaagggtgacaaatca
ccttacaaaatttctactgaagcagataagtcactcgctgaagatggacatttaattgct
cctattaagaaagatacaaaggtgggttccatcgttttagaatcaactgataaatatggt
ttcttagatggaaataagagcatgaaggttgctgcaaaaacgacagaagaagtagaaaaa
gcaaattggttcgtattaacaatgcgttccgttggtgatttcttctcaaacttatggtcc
aaaatattttaa

DBGET integrated database retrieval system