KEGG   Bacillus thuringiensis MC28: MC28_5059Help
Entry
MC28_5059         CDS       T02263                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
btm  Bacillus thuringiensis MC28
Brite
KEGG Orthology (KO) [BR:btm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MC28_5059 (ahpF)
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MC28_5059 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_binding_3 FAD_oxidored Thi4 DAO AlaDh_PNT_C Glutaredoxin K_oxygenase NAD_binding_8 Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFU16481
UniProt: K0FWU1
LinkDB All DBs
Position
complement(4991691..4993109)
Genome map
AA seq 472 aa AA seqDB search
MLSLVDELATMSSKITVEKVELERTPSFSVNRPDEDTGVVFAGIPLGHEFTSLVLALLQV
SGRAPKVEQKLIDQIKNIQGEYHFESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGA
AFKEEVESKDIMAVPTVFLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGG
GPAGASAAIYAARKGIRTGIVAERFGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEY
DIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAY
CPHCDGPLFIGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLP
NVTVLKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERA
RGEIVTDKHGATNVPGVFAAGDCTNNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttatctctagtagatgaattagctactatgtcatcaaagattacagtagaaaaagtt
gaactagagagaacaccaagctttagtgtaaatcgccctgatgaagacactggtgtagta
ttcgctggtattccattaggacacgaatttacttcattagtgttagctttactacaagtt
agtggacgtgctccaaaagttgaacaaaaattaatcgatcaaattaaaaacattcaaggc
gaatatcattttgaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaa
gctcttaacgtaatgagcgttcttaactctggtattacacatactatgattgatggcgct
gcattcaaagaggaagtagaaagcaaagacatcatggcagtaccaacagttttcctaaat
ggcgaatctttcggaagcggtcgtatgacacttgaagaaattttagctaaaatgggtaac
ggtccagatgcatcagagctttctgataaagatccatacgatgttcttgttgttggtggc
ggcccagctggtgcaagtgcagcaatttatgcagcacgtaaaggcatccgcactggtatc
gttgctgagcgcttcggtggtcaagtaatggatactatgggtattgagaacttcatcagc
gtaaaacgcactgaaggtcctaagctagtagcaagccttgaagagcacgtaaaagaatac
gacatcgatgtaatgaatctacaacgtgcgaaacgtttagagaaaaaagaacttattgaa
gtggaacttgaaaacggcgctattctgaaaagtaagagcgtaatcgtttctacaggtgct
cgctggcgtaatgttggcgtaccaggtgaagctgagttcaaaaataaaggtgtagcatac
tgcccacactgtgacggtccattattcatcggaaaagatgtagcagttattggcggaggt
aactctggtattgaagcagctatcgacttagcaggtattgttaagcacgtaactgttctt
gaattcatgccagaattaaaagctgatgctgtattacaagagcgtcttaacagcttacca
aacgtaactgttctgaaaaacgttcaaacgaaagaaatcactggtactgacaaagtaaac
ggtatttcttacatcgatcgtgaaactgaagaagttcatcacgttgaattacaaggtgta
ttcgttcaaatcggtcttgtgccaaacacagactggttaggcgaaacagttgaacgcgct
cgcggtgaaatcgtaacagacaagcacggcgctacaaacgtaccaggagtgtttgctgca
ggtgactgtacaaataatccgtacaaacaaatcatcatctctatgggttcaggtgcaaac
gctgctttaggcgcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system