KEGG   Bacillus thuringiensis MC28: MC28_5326Help
Entry
MC28_5326         CDS       T02263                                 

Gene name
npr
Definition
(GenBank) Bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
btm  Bacillus thuringiensis MC28
Brite
KEGG Orthology (KO) [BR:btm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:btm01002]
    MC28_5326 (npr)
Enzymes [BR:btm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     MC28_5326 (npr)
Peptidases [BR:btm01002]
 Metallo Peptidases
  Family M4: thermolysin family
   MC28_5326 (npr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AFU16748
UniProt: K0FXP9
LinkDB All DBs
Position
5275197..5276897
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLAAGMAGTTFGGTGSAFADSKNVLSTKKYNETVKSPEFISGDLTGATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIAIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKYNKLDHVTNEDKSPVKQDAPK
QEAKAAAKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRSTL
PGTLWADADNVFNAAYDAAAVDAHFYAGRTYDYYKATFNRNSINDAGAPLKSTVHYGSKY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSDLIYQNESGALNEAISD
IFGTLVEYYDNRNPDWEIGEDIYTPGKAGDALRSMSDPAKYGDPDHYSKRYTGTSDNGGV
HTNSGIINKQAYLLANGGTHSGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGASSAEVNAVKQSFSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcggcagggatggcaggtactacatttgga
gggacaggctctgcgtttgcagattcaaaaaatgtgctctctacgaagaagtacaatgag
acagtgaagtcgcctgagtttatttctggtgatctaactggagcaactggcaagaaagcg
gaatctgttgtgtttgattatttaaatgcagcaaaaggtgattataagctaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagtgaaaaaagatgctgtaactgattcaaca
gtagtacgtatgcaacaagtttacgaaggagtacctgtatggggttctactcaagtagct
cacgtaagtaaagatggttctttaaaagtattgtctggaacagttgcacctgatttagac
aagaaagaaaagttgaaaaataaaaataagattgaaggcgcaaaagcgattgcaatcgcg
cagcaagatttaggtgtaacaccgaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaacggtgaagaaacaacatatgcatatgttgtaaatctaaacttcttagatcca
agcccaggaaactactactatttcattgaagcagacagcggcaaagtgttaaataaatat
aataaacttgatcatgtaacaaatgaagataagtcaccagttaagcaagatgctcctaaa
caggaagcaaaagctgctgcaaagccagtaacaggaacgaataaagtgggaactggtaaa
ggtgtattaggagatacgaaatcgcttaatacaacgttatctgggtcatcttactacttg
caagataatacgcgcggggcaacaattttcacatatgatgcgaaaaatcgttcaacatta
ccgggaacattatgggcagatgcagataatgttttcaatgcagcgtatgatgcagcagca
gtagatgctcatttctatgctggtagaacatatgattattataaagctacattcaataga
aactctattaatgatgcaggagcaccattaaaatcaacagttcattacggaagtaagtat
aataatgcattctggaacggttcacaaatggtatacggagatggtgatggtgtaacattc
acttcattatctggtggaattgatgtaattggtcacgaattaacgcatgctgttacggaa
aatagctcggatttaatttatcaaaatgaatcaggagcgctaaatgaagcaatttctgat
atctttggtactttagtagaatactatgataatcgtaatccagattgggaaattggtgaa
gatatttacacgcctggtaaagcaggagatgcacttcgctctatgagtgatccagcgaaa
tatggtgacccagaccattattctaagcgttacactggtactagtgataacggtggggtt
catacgaacagtggtattattaacaagcaagcttatttattagcaaatggcggtacgcat
tctggtgtaactgtaactggtattggtaaagataaattaggtgcgatttactaccgtgca
aatacacagtatttcacgcaatctactacatttagtcaagctcgtgctggtgcagtacaa
gctgcagcggatttatatggtgctagctctgcagaagtaaatgcagtgaagcaatcattt
agtgctgttggtgtaaactaa

DBGET integrated database retrieval system