KEGG   Bacillus thuringiensis HD-789: BTF1_03375Help
Entry
BTF1_03375        CDS       T02411                                 

Definition
(GenBank) competence transcription factor
  KO
K02250  competence protein ComK
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:btn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BTF1_03375
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:btn03000]
    BTF1_03375
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:btn02044]
    BTF1_03375
Transcription factors [BR:btn03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BTF1_03375
Secretion system [BR:btn02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BTF1_03375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: AFQ24898
LinkDB All DBs
Position
679359..679940
Genome map
AA seq 193 aa AA seqDB search
MESKVERYVENYVVTKNTMALLPVILSEKKIVTRVVEMNDSFFVFQKPLDIIERSCRKHG
SSFLGRKEGTKELTHITHKAPIAISPTDQLYFFPTYSYSRKECAWLSHFYIEGNKELKDG
NLIIRFINGFAVKLEISKTSFENQQNRTAKLRTEYEDRRKKQGSPCFKEIDKKEESTLRP
AYERVYFVKEGEV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtggaacgctatgtcgaaaattatgttgtaacgaaaaatacgatggcc
ttacttcctgttattctaagtgaaaagaaaattgttacgcgagtcgttgaaatgaatgat
tcttttttcgtatttcaaaaaccactagatattatagaaagaagttgccgaaagcatggt
tctagtttcttaggcagaaaagaaggaacgaaagaattaactcatattacacataaagca
ccgattgcgattagtcctacagatcaactttattttttccctacctattcttactctaga
aaagagtgcgcttggttgtctcatttttatattgaaggtaataaagaattaaaagatgga
aatcttattattaggtttataaatggctttgctgtgaaattagaaatatcaaaaactagt
tttgaaaatcaacaaaatcgtacagcgaaattgcgtactgaatatgaagatcgtaggaaa
aaacaagggagcccttgttttaaagagattgataaaaaagaggaatcaacattaagacct
gcttatgagagagtgtattttgtgaaggaaggcgaagtgtga

DBGET integrated database retrieval system