KEGG   Bacillus thuringiensis HD-789: BTF1_03830Help
Entry
BTF1_03830        CDS       T02411                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00061  Fatty acid biosynthesis
btn00780  Biotin metabolism
btn01100  Metabolic pathways
btn01130  Biosynthesis of antibiotics
btn01212  Fatty acid metabolism
Module
btn_M00083  Fatty acid biosynthesis, elongation
btn_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:btn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BTF1_03830
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BTF1_03830
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BTF1_03830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:btn01004]
    BTF1_03830
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BTF1_03830
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BTF1_03830
Lipid biosynthesis proteins [BR:btn01004]
 Fatty acid synthase
  Component type
   BTF1_03830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AFQ24987
LinkDB All DBs
Position
770886..771656
Genome map
AA seq 256 aa AA seqDB search
MELLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVRELADTLEGQES
LVLPCDVTNDEELTACFETIKQEVGTIHGVAHCIAFANRDDLKGEFVDTSRDGFLLAQNI
SAFSLTAVAREAKKVMTEGGNILTLTYLGGERVVKNYNVMGVAKASLEASVKYLANDLGQ
HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRTTTPEEVGDTAVFLFSDLARG
VTGENIHVDSGYHILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaactattacaagggaaaacatttgttgttatgggcgttgcgaaccaaagaagtatt
gcgtggggaattgctcgctctttgcataatgcaggtgcaaaattaatcttcacatatgca
ggagaacgtttagaaagaaatgttcgtgaattagcggatacattagaaggacaagaatca
cttgtattaccttgtgatgtaacaaatgatgaggaacttacagcttgctttgaaacaatt
aaacaagaagtaggtactattcacggtgtagcacattgtattgcttttgcaaatcgcgat
gacttaaaaggcgaatttgtagatacttctcgcgatggatttttacttgcacaaaatatt
agtgcattctctttaacagctgtagcaagagaagcgaagaaagttatgacagaaggcgga
aatattttaacgttaacataccttggcggcgagcgtgttgtgaaaaattataacgttatg
ggtgttgcgaaagcttcattagaagcgagcgtgaaatatttagcaaacgatttaggtcaa
catggtattcgtgtcaacgctatttctgcaggaccaattcgtacgttatctgcaaaaggt
gtaggcgatttcaactcaatcttaagagaaattgaggagcgcgcaccacttcgtcgtaca
acaactccagaagaagttggcgatacagcagtattcctattcagtgatttagctcgcggt
gtaacaggagaaaacattcatgttgattcagggtatcatatcctaggataa

DBGET integrated database retrieval system