KEGG   Bacillus thuringiensis HD-789: BTF1_07095Help
Entry
BTF1_07095        CDS       T02411                                 

Definition
(GenBank) ABC transporter CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:btn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTF1_07095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btn02000]
    BTF1_07095
Transporters [BR:btn02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BTF1_07095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 RsgA_GTPase SMC_N DUF87 MMR_HSR1 AAA_29 AAA_16 AAA_5 AAA_22 AAA_24 AAA_28 AAA_23 AAA_30 TMEM132D_C AAA_18 Wzy_C
Motif
Other DBs
NCBI-ProteinID: AFQ25632
LinkDB All DBs
Position
1390878..1392602
Genome map
AA seq 574 aa AA seqDB search
MSNWVKPYIKQNKGRMTLTIFLGLLGVSSGAMLLFISGYLISKSALRPENVMAVYVPIVA
TRAFSIGQAVFHYIERLVGHDVVLRILEKMRTKLYRIVEPQALFFRSRFQTGDMLGVLSE
DIEHLQNLYLRTIFPSILALVVYSIFVLVIGAFDLVFALIVGCMLAIIVFLLPFVSLLLM
KKHHVTLKQGRSRLYQQLTDAVFGLSDWQASGRKGEFINEYVKQNDQLLKIEKRVKRWYH
IRDSIIQSVVGIVVISMIIWTGNEAASEQIAPTVIAAFVLMTLSVTNALIPIADAIDRIP
SYVESTHRLNGVESDIVLHDKMDLYGDNDYVEPRHVDIELNHVSYSYPDSNEIVLKDVSL
QIKAGKKIAILGRSGTGKSTLLKLLTGALSPVNGQVVLNGERAHTNLLSKYISVLNQKPH
LFDTTIGNNVRIGKPEATDEEIWKALEKAQLASHITSLPDGLQTKMHEMGKRFSGGERQR
VAFARTLMQETPIIVLDEPTIGLDPKTELSLIETMFSATEEKTVIWITHHLVGIEHVDEV
IFLDRGQIVMQGSHKQLLKENEKYRKLYELDKGI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactgggttaaaccttatataaaacaaaataaaggtagaatgactttaactatt
ttccttggtcttcttggagttagttcaggagcgatgttactttttatttcaggttattta
atctcaaaatctgcccttagaccagaaaatgtaatggctgtatatgttcctattgttgca
acaagagcgtttagtatagggcaagctgtgtttcattatatagagcgcttagtcggacat
gatgtcgtactacgtatattagaaaaaatgagaacgaagctatatagaatagtagaacca
caggcgttatttttccgttctcgatttcaaacgggtgatatgttaggagtgttatccgaa
gatatagagcatttgcaaaacctatatttacgtacaatatttcctagtatattagcgcta
gttgtttatagtatcttcgtacttgttatcggtgcatttgaccttgtgtttgcacttatt
gtaggttgtatgttagctattatcgtgtttcttcttccatttgtatcattacttttgatg
aagaaacaccatgttactttaaagcaaggcagaagccgtttgtatcaacaactgacggat
gctgtttttggattatctgattggcaggcaagtggtcgtaaaggtgaatttattaatgag
tatgtaaaacaaaatgatcagttgttaaaaatcgaaaagagagtgaaacgctggtatcat
attcgggacagtatcattcaatcagtagtaggtattgtagttatttcgatgattatatgg
actggaaatgaagcggcaagtgagcaaattgctcctacagttatcgcagctttcgtatta
atgactttatctgtaacgaatgcgcttattcctattgcagatgccatcgatcgaatcccg
tcgtatgtagaatctacccatcgtcttaatggcgtagaaagtgatattgttttacatgat
aaaatggatttgtatggagataatgattacgttgaaccaagacatgtagatattgaactg
aatcacgtatcgtatagttatccagatagtaatgagattgtattaaaagacgtatcatta
caaataaaagcagggaagaaaattgctattttaggcagaagtgggacagggaaatctact
ttactaaaattgttaacaggggcgttaagcccagtaaacggccaagttgtattgaatggt
gaacgagctcatacgaatcttttatctaaatatatttctgtattaaatcaaaagccccat
ttgtttgatacgacaattggaaataatgtacgaattggcaaaccagaggcgacggatgaa
gagatatggaaagctttagagaaagcacaattagcttcacatattacttctcttccggac
ggattacaaacaaaaatgcatgaaatgggaaagcggttttctggtggtgaaagacaaagg
gttgcttttgctagaactcttatgcaagaaacacccatcattgtacttgatgaaccgact
atcggtttagatccgaaaacagaattgtctttaattgaaacaatgttttctgcaacggaa
gaaaagacggttatttggattacgcaccatcttgtaggaatagaacatgtagacgaagtt
atattccttgatcgtggccaaattgtcatgcaaggtagtcataaacaacttctgaaagaa
aatgaaaagtatcgtaaactttatgagttagataaaggaatatga

DBGET integrated database retrieval system