KEGG   Bacillus thuringiensis HD-789: BTF1_21540Help
Entry
BTF1_21540        CDS       T02411                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00010  Glycolysis / Gluconeogenesis
btn00030  Pentose phosphate pathway
btn00051  Fructose and mannose metabolism
btn00052  Galactose metabolism
btn00680  Methane metabolism
btn01100  Metabolic pathways
btn01110  Biosynthesis of secondary metabolites
btn01120  Microbial metabolism in diverse environments
btn01130  Biosynthesis of antibiotics
btn01200  Carbon metabolism
btn01230  Biosynthesis of amino acids
btn03018  RNA degradation
Module
btn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:btn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTF1_21540
   00030 Pentose phosphate pathway
    BTF1_21540
   00051 Fructose and mannose metabolism
    BTF1_21540
   00052 Galactose metabolism
    BTF1_21540
  09102 Energy metabolism
   00680 Methane metabolism
    BTF1_21540
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BTF1_21540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:btn01009]
    BTF1_21540
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:btn03019]
    BTF1_21540
Enzymes [BR:btn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BTF1_21540
Protein phosphatases and associated proteins [BR:btn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BTF1_21540
Messenger RNA biogenesis [BR:btn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BTF1_21540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AFQ28477
LinkDB All DBs
Position
complement(4164219..4165178)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEEYDMDDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGKGGRCVGIQDNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggattaatttctggtcacattgaaaaattagaacttggttctgttggcgatatt
atccaccgcggtggtacgaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggtatcgagcaattaaagaaacatggtatcgaaggacttgttgttatt
ggtggagatggttcttaccaaggcgctaaaaaattaactgaacaaggattcccgtgtgtt
ggtgtaccaggtacaatcgacaatgatatccctggaacagacttcacaattggtttcgat
acagctttaaacactgttattgatgcaattgataaaatccgtgacacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggtgatatcgcattatgggct
ggtttagctgatggtgcagaaacaatcttaattccagaagaagagtatgacatggatgat
gttatcgctcgtctgaagcgtggtagtgaacgtggtaaaaaacacagtattatcgttgta
gctgaaggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaaacttt
gatactcgtgtaactgtattaggtcacgtacaacgtggtggatcaccaagtgcacaagac
cgtgtattagcaagtcgtcttggcgcaagagcagttgaattattaattgctggtaaaggt
ggacgttgtgtaggtattcaagataacaaacttgttgatcatgatattatcgaagcgtta
gctcaaaagcatacaatcgataaagatatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system