KEGG   Bacillus thuringiensis HD-789: BTF1_24160Help
Entry
BTF1_24160        CDS       T02411                                 

Definition
(GenBank) MutT/NUDIX family protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
btn  Bacillus thuringiensis HD-789
Brite
KEGG Orthology (KO) [BR:btn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:btn03400]
    BTF1_24160
Enzymes [BR:btn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BTF1_24160
DNA repair and recombination proteins [BR:btn03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BTF1_24160
 Prokaryotic Type
    BTF1_24160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AFQ28997
LinkDB All DBs
Position
complement(4648303..4648761)
Genome map
AA seq 152 aa AA seqDB search
MQRVTNCVLIRDNEVLLLQKPRRNWWVAPGGKMERGETVRDSVVREYREETGIYLKNPAL
KGVFTFVIQEGDKVVSEWMMFSFLATDFAGENKLESEEGIIGWHTFDKIDDLAMAPGDYH
IIDYLIKGNGIIYGTFVYTPDFELLSYRLDPS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagtgacaaactgtgtgttaattagagataatgaagtactcttactccaaaaa
cctcgccgaaattggtgggttgcaccaggcgggaaaatggagcgtggtgagactgtaaga
gattccgttgttcgcgagtatcgtgaagaaacaggtatttatttgaaaaacccagcgtta
aagggggtcttcacctttgtcatccaagaaggtgataaagttgtttctgaatggatgatg
ttctcctttttagcgacagattttgcaggagaaaacaaactagagagcgaagaaggcatc
attggttggcatacatttgacaaaattgatgatttagcaatggcgccaggagattatcac
attattgattacttaattaaaggaaatggcataatctacggtacatttgtatatacccca
gattttgagttgctttcatatcgattagatccgagttaa

DBGET integrated database retrieval system