KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_1040Help
Entry
WQG_1040          CDS       T02504                                 

Definition
(GenBank) Dihydropteroate synthase type-2
  KO
K18824  dihydropteroate synthase type 2 [EC:2.5.1.15]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00790  Folate biosynthesis
bto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WQG_1040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bto01504]
    WQG_1040
Enzymes [BR:bto01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     WQG_1040
Antimicrobial resistance genes [BR:bto01504]
 Gene variants
  Sulfonamide resistance genes
   Dihydropteroate synthase
    WQG_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AGH37389
UniProt: M4R6K4
LinkDB All DBs
Position
98550..99578
Genome map
AA seq 342 aa AA seqDB search
MGNVSSHTYTYAGKRSFACNCEENNGKCGLAPPNNRFERTHGTSPFAAQPKVRLTPSARR
KMEYTSKSQIARNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGP
ASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGF
PDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRN
RLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGA
ATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgtaagttcccatacctatacatacgcaggaaaacgatcatttgcttgcaat
tgcgaagaaaataatggaaaatgtggactggcgccacctaacaaccggttcgagcggact
cacgggacaagcccgttcgcagctcaaccgaaagttaggttgacgccttcggcgcggagg
aaaatggaatatacaagtaaatcacaaatagctcgaaataaatcgctcatcattttcggc
atcgtcaacataacctcggacagtttctccgatggaggccggtatctggcgccagacgca
gccattgcgcaggcgcgtaagctgatggccgagggggcagatgtgatcgacctcggtccg
gcatccagcaatcccgacgccgcgcctgtttcgtccgacacagaaatcgcgcgtatcgcg
ccggtgctggacgcgctcaaggcagatggcattcccgtctcgctcgacagttatcaaccc
gcgacgcaagcctatgccttgtcgcgtggtgtggcctatctcaatgatatccgcggtttt
ccagacgctgcgttctatccgcaattggcgaaatcatctgccaaactcgtcgttatgcat
tcggtgcaagacgggcaggcagatcggcgcgaggcacccgctggcgacatcatggatcac
attgcggcgttctttgacgcgcgcatcgcggcgctgacgggtgccggtatcaaacgcaac
cgccttgtccttgatcccggcatggggttttttctgggggctgctcccgaaacctcgctc
tcggtgctggcgcggttcgatgaattgcggctgcgcttcgatttgccggtgcttctgtct
gtttcgcgcaaatcctttctgcgcgcgctcacaggccgtggtccgggggatgtcggggcc
gcgacactcgctgcagagcttgccgccgccgcaggtggagctgacttcatccgcacacac
gagccgcgccccttgcgcgacgggctggcggtattggcggcgctgaaagaaaccgcaaga
attcgttaa

DBGET integrated database retrieval system