KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_10900Help
Entry
WQG_10900         CDS       T02504                                 

Definition
(GenBank) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00061  Fatty acid biosynthesis
bto00780  Biotin metabolism
bto01100  Metabolic pathways
bto01130  Biosynthesis of antibiotics
bto01212  Fatty acid metabolism
Module
bto_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WQG_10900
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    WQG_10900
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    WQG_10900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bto01004]
    WQG_10900
Enzymes [BR:bto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     WQG_10900
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     WQG_10900
Lipid biosynthesis proteins [BR:bto01004]
 Fatty acid synthase
  Component type
   WQG_10900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF4570
Motif
Other DBs
NCBI-ProteinID: AGH38367
UniProt: M4RIX9
LinkDB All DBs
Position
complement(1178373..1179155)
Genome map
AA seq 260 aa AA seqDB search
MSFLAGKRILITGLASNRSIAYGIAKAMKAQGAELAFTYLNDKLKARVEEFATEFGSDIV
LPMDVAFDDSITNCFAELSKKWEKFDGFVHSIGFAPGDQLDGDYVNAATREGFRIAHDIS
AYSFVAMAQAARPYLNPNSALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADMGKD
GIRVNAISAGPIRTLAASGIKDFKKMLSSFEKTAPLRRCVTIDDVGNSAAFLCSDLAGGI
TGEVVHVDAGYSTVAMGDIE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagctttttagcaggtaaacgtattttaatcactggcttagccagcaaccgttctatt
gcttacggcattgccaaagcaatgaaagcacaaggtgcagagctggctttcacctactta
aatgataaattgaaagctcgcgtggaagaatttgcaactgaatttggttcagacattgtt
ttaccaatggatgtggcatttgatgatagcatcacgaattgttttgctgaacttagcaaa
aaatgggaaaaatttgatggttttgtgcattctatcggctttgctcctggcgatcagctc
gatggtgattatgtaaacgctgcaacccgcgaaggtttccgtattgcgcacgatattagt
gcatatagttttgtagcaatggcacaagctgctcgcccatacttaaatccaaactcggca
cttttaacgctgtcttatttaggtgcagaacgtgcaattccaaactacaatgtaatgtgc
ttggcaaaagcgtctcttgaagccgcaactcgtgtgatggctgccgatatggggaaagat
ggtattcgtgtcaatgcgatttccgcaggcccaatccgcactcttgctgcaagtggtatc
aaagacttcaagaaaatgttgtctagctttgaaaaaactgctccattacgccgttgtgta
accattgatgatgtgggtaattctgcggcattcctatgttctgatttagcaggcggtatc
actggcgaagtcgtacacgttgatgctggttatagcacagtagcgatgggtgatattgaa
taa

DBGET integrated database retrieval system