KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_18050Help
Entry
WQG_18050         CDS       T02504                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bto01100  Metabolic pathways
bto01110  Biosynthesis of secondary metabolites
bto01130  Biosynthesis of antibiotics
bto01230  Biosynthesis of amino acids
Module
bto_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    WQG_18050
Enzymes [BR:bto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     WQG_18050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 Cytidylate_kin AAA_17
Motif
Other DBs
NCBI-ProteinID: AGH39082
UniProt: M4RL61
LinkDB All DBs
Position
complement(1961612..1962097)
Genome map
AA seq 161 aa AA seqDB search
MGAGKSTIGRQLAQMLNMDFLDSDSVIEERAGADIDWIFDIEGEEGFRKREERVLNELTQ
SQGLVLSTGGGSIISKDNRNVLSARGIVVYLETTLDKQFERTQRDKKRPLLQTEDPYQTL
VELAKVRNPLYEEIADITIKTDEQSAKVVANQIIDMMDNLQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccggtaaaagcactattgggcgtcaattggctcaaatgttgaatatggatttt
ttagattctgacagcgtgattgaagaaagagctggagctgatattgattggattttcgat
attgaaggggaagaaggattccgtaaacgtgaagagcgtgttttaaatgaactgacacag
tctcaaggtttagttctttccactgggggtggttcgattatttctaaagataaccgtaat
gtgttatctgcacgcggtattgtggtttacctagaaacaacgcttgataagcaatttgaa
cgtacccagcgtgataaaaaacgtccactattgcaaacagaagatccgtatcaaacttta
gttgagttagctaaggtgcgtaacccgctttatgaagagattgccgatattacgattaaa
accgatgagcagagcgctaaagtcgttgctaatcagattatcgacatgatggacaattta
caataa

DBGET integrated database retrieval system