KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_22580Help
Entry
WQG_22580         CDS       T02504                                 

Definition
(GenBank) Penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00550  Peptidoglycan biosynthesis
bto01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bto00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WQG_22580
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    WQG_22580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bto01011]
    WQG_22580
Enzymes [BR:bto01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     WQG_22580
Peptidoglycan biosynthesis and degradation proteins [BR:bto01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   WQG_22580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DnaGprimase_HBD
Motif
Other DBs
NCBI-ProteinID: AGH39535
UniProt: M4R8Q6
LinkDB All DBs
Position
complement(2405223..2407166)
Genome map
AA seq 647 aa AA seqDB search
MFSLLSKWVKPKKYEKVRNGQAEKNLFIRRALIAFLGVLGLTGILLTNLYNLQVVNYESY
ETRSNGNRIKLLPVPPTRGLIYDRNGKVLAENITYFGLYIIPEKVDNLEQTLDELKALIG
LSDEDIEHFYKEKKRASRYTPILLKPDLNEEQIARFSVNQHRFPSMDVHPYFKRNYPYGE
MMTHIIGYVAKINDKDKKRLIEEGKFGNYAGSHDIGKLGIEKYYEEQLHGITGFEEVEIN
NRGKVIRKLRDQPAVDGSSVKLTIDIELQRYITNLLGRQKGAIVVLDPNDSSILAMVTNP
TYDNNLFVGGISGKDYKLLLEDEDRPLLSRATQGTYPPASTIKPFMAVAGLTEGKITPTS
SVFDPGYWIVPGTTQRFRDWKKSGHGHTNVNKAIVESADTYFYQLAYDMGIDKMSAWMKM
FGFGMPTGIDLHEESVGIMPSREWKQKRHKKPWLQGDTVNTGIGQGFWIATPLQLAKATA
VLINDGKVNTPHLMKEVLSGEIMPYQDPKLYDDIQGVPQRFWQISKLGMYNVNHASNGTG
RKAFAGAFYKSAGKTGTAQVFSLKGKDYNKNTIAKKLHDHGWFIGYAPYENPKMVISVIL
ENAGGGGSTAAPMARKVMDYTLRHLNDQPNLQNNSENQPLATESDSE
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtttgctctccaaatgggttaaaccgaaaaaatatgaaaaagttcgcaacggc
caagcagagaaaaacctgtttatccgtcgtgcgttgatcgcttttttaggggtgcttgga
ttaactgggattttgctaactaacctgtataacttacaggtggtcaattatgaatcctat
gaaactcgttcaaacggaaaccgtattaaattattgcccgtaccacctactcgaggctta
atttatgatcgtaatggtaaggttttagcggaaaatatcacctatttcgggctctatatt
attcccgaaaaagtggataacttagagcaaactctagatgaactcaaggctttgattggg
ttgagcgatgaggatattgaacatttttataaagagaagaaaagagcctctcgctatacc
ccaatcttgcttaaacctgatttaaatgaggaacaaattgcgcgtttttcggtaaatcag
catcgttttccaagtatggatgttcatccttattttaagcgaaattacccttatggcgag
atgatgacgcacattatcggctatgtcgcaaagattaatgacaaggataaaaagcgatta
attgaagagggtaaatttggtaattatgcaggttcgcacgatattggaaagctaggtatt
gaaaaatattatgaagaacaactgcatggtatcacgggctttgaagaagtagaaattaat
aaccgaggcaaggttattcgtaaattgcgcgatcaacctgcggtggatggtagtagtgtc
aaattgacgattgatatagaactgcaacgctatattacaaatttgctcggcagacagaaa
ggggccattgtggtattggatcctaatgatagcagtattctcgcaatggtaaccaaccct
acctacgataacaatttatttgtagggggaatttctggcaaagattataaactcttactt
gaagatgaagatcgcccattgttgagccgagcaacgcaaggaacttatccgccagcttct
acgattaaaccctttatggctgtagcagggctaaccgaaggtaaaattacaccaacgtct
agtgtatttgatcctggttattggattgtaccagggacaacccagcgtttccgcgattgg
aaaaaaagtggacatgggcataccaatgtgaataaggcgattgtcgaatcggcagatact
tatttttatcagctcgcctacgatatgggcattgataaaatgtcggcgtggatgaagatg
tttggttttggcatgccaacaggtattgatttgcatgaagaatctgttggaatcatgcct
agccgtgaatggaaacaaaaacgtcataaaaaaccgtggttacaaggtgatactgttaat
actgggattgggcaaggattctggattgctacaccattacagttggcaaaagcaacggca
gtattaattaacgatggtaaggtaaatacgccacatttaatgaaagaggtgttgtcggga
gagataatgccttaccaagatccaaaactgtacgatgatattcaaggtgtcccccaacgt
ttttggcagatttcaaaattgggtatgtataacgtaaatcatgcaagtaatggtacaggg
agaaaagcttttgctggtgcattttacaaatctgcaggcaaaacaggtacagcacaggtt
ttcagtttaaaagggaaagattacaacaaaaatacgattgcgaaaaagctacatgaccac
ggctggtttattggttatgccccttatgagaaccctaaaatggttatctcagtgatttta
gaaaatgctggtgggggcgggagcaccgcagcaccgatggcaagaaaagtaatggattac
accttaagacatttaaacgaccaaccaaatttgcaaaataatagcgaaaatcaaccgctt
gcaacggagagtgatagtgagtaa

DBGET integrated database retrieval system