KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_2730Help
Entry
WQG_2730          CDS       T02504                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Brite
KEGG Orthology (KO) [BR:bto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bto03012]
    WQG_2730
   03029 Mitochondrial biogenesis [BR:bto03029]
    WQG_2730
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bto04147]
    WQG_2730
Translation factors [BR:bto03012]
 Eukaryotic Type
  Elongation factors
   WQG_2730
 Prokaryotic Type
   WQG_2730
Mitochondrial biogenesis [BR:bto03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    WQG_2730
Exosome [BR:bto04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   WQG_2730
  Exosomal proteins of breast cancer cells
   WQG_2730
  Exosomal proteins of colorectal cancer cells
   WQG_2730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AGH37556
UniProt: M4R3D3
LinkDB All DBs
Position
259100..260308
Genome map
AA seq 402 aa AA seqDB search
MFKGNLKMAKEQFNRGDKVHVNVGTIGHVDHGKTTLTAAITTVLAKHFGGAARAFDQIDN
APEEKARGITINTSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGP
MPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYEFPGDDTPIVR
GSALQALNGVPEWEEKILELAGHLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRV
ERGIIKSGEEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENVGALLRGTKREEIERGQV
LAKPGSITPHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVM
PGDNIKMTVNLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaaggaaacttaaaaatggcaaaagaacagtttaaccgtggtgataaagtccac
gtaaacgtgggtacaatcggtcacgttgaccatggtaaaaccactttaacagcagcaatt
actaccgttttagcaaaacacttcggtggtgcagctcgtgcattcgaccaaatcgacaat
gcaccagaagaaaaagcgcgtggtatcaccatcaacacttcacacgttgaatacgaaacc
gcaactcgtcactatgctcacgttgactgcccaggacacgcggactatgtgaaaaacatg
atcaccggtgcggcacaaatggacggcgctatcttagtagtagcagcaacagacggtcct
atgccacaaactcgtgagcacatcttattaggtcgccaagtaggtgttccatacatcatc
gtattcttaaacaaatgcgatatggtagatgacgaagagttattagaattagttgaaatg
gaagttcgtgaacttctttctcaatacgaattcccaggtgatgacacaccaatcgtacgt
ggttctgcgttacaagcattaaacggcgtaccagagtgggaagaaaaaatccttgaatta
gcaggtcacttagattcttacattccagagccagagcgtgcgattgataaaccattctta
ttaccaatcgaagacgtattctcaatctctggtcgtggtactgtagtaacaggtcgtgtt
gagcgtggtatcatcaaatcaggtgaagaagttgaaatcgtaggtatcaaagaaaccacc
aaaacaactgtaactggtgttgaaatgttccgtaaattacttgacgaaggtcgtgcaggt
gaaaacgtaggtgcattattacgtggtaccaaacgtgaagaaatcgaacgtggtcaagta
cttgctaaaccaggttcaatcacgccacacacagacttcgaatcagaagtttacgtatta
tcaaaagaagaaggtggtcgtcacactccattcttcaaaggttaccgtccacagttctac
ttccgtacaactgacgtaacaggtacaatcgagttaccagaaggtgttgaaatggtaatg
ccaggcgacaacatcaaaatgactgtaaacttaattcacccaatcgcaatggacgaaggt
ttacgttttgcaattcgtgaaggtggtcgtacagtaggtgcgggcgttgtagcgaaaatc
atcaaataa

DBGET integrated database retrieval system