KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_5560Help
Entry
WQG_5560          CDS       T02504                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00471  D-Glutamine and D-glutamate metabolism
bto00550  Peptidoglycan biosynthesis
bto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    WQG_5560
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WQG_5560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bto01011]
    WQG_5560
Enzymes [BR:bto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     WQG_5560
Peptidoglycan biosynthesis and degradation proteins [BR:bto01011]
 Precursor biosynthesis
  Amino acid ligase
   WQG_5560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AGH37836
UniProt: M4R431
LinkDB All DBs
Position
575846..577273
Genome map
AA seq 475 aa AA seqDB search
MKNFQDKVRKIIPEMRRVKQIHFIGIGGAGMCGIAGVLLNEGYQISGSDIAENAAVQGLK
EAGAKVFIGHQAENVQGASVVVASTAINEDNPEIVAAREARIPVIQRAQMLAEIMRFRHG
IAIAGTHGKTTTTAMISMIYTQAGLDPTFVNGGLVKSAGKNAHLGASRYLIAEADESDAS
FLHLQPMVSVVTNIEPDHMDTYGGDFEKMKETYVKFLRNLPFYGLTVACADDDVVLEVAA
KAGRQTLTYGFNEKADYRIEDYQQTGFQGHYTVICPNGERIDVLLNVPGKHNALNATAAL
AVAKEEGIANDAILAALADFQGAGRRFDQLGSFIRPNGKVMLVDDYGHHPTEVDVTIKAA
RQGWENKRIVMVFQPHRYSRTRDLFDDFVQVLSQVDALIMLNVYAAGESPIIGAESKDLC
RSIRNLGKVDPILVSDVSQLGEVLDQVIQDGDLVLAQGAGNVSKLSRDLAESWKA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatttccaagataaagtacgaaaaattattccagagatgcgtcgcgtaaagcag
atccattttatcgggattggcggtgcgggtatgtgcggtattgcaggtgttttacttaat
gaaggctaccaaatttcagggtctgatatcgctgaaaatgccgcagtgcaaggcctaaag
gaagcaggggcaaaagtttttattggtcatcaagcggaaaacgtgcaaggtgcgagtgtg
gttgtggcatcaactgcaattaatgaagataatccagaaattgttgctgctcgtgaagcg
cgtattcctgtgattcaacgtgcgcaaatgttggcggagattatgcgttttcgccacgga
attgccattgcaggcacacacggaaaaacgactacaaccgcaatgatttcaatgatttat
actcaagcgggtttagatccaacttttgtcaatggtgggttagtgaaatctgctgggaaa
aatgcccatttaggagcaagccgttatctgattgcagaagcggatgagagtgatgcctct
ttcttgcatttacaaccaatggtgtcggtcgttactaatattgagccggatcatatggac
acctatggtggcgattttgaaaaaatgaaagagacttatgtgaagtttctgcgcaactta
ccattttatgggctaacagtggcttgtgctgatgatgatgtagtgcttgaggtggcagcg
aaagccggacgccaaacgctcacgtatggttttaatgaaaaagcagattaccgaattgaa
gattatcagcaaacaggatttcaagggcattacacggtgatttgtccgaatggggagcgt
attgacgtattgctcaatgtccctggcaaacacaatgcattaaatgcaacggcagcattg
gctgtagcaaaagaagaaggcattgcaaatgatgccattttagctgcattggcagatttc
caaggagcgggcagacgttttgatcaactcggttcattcattcgtccaaatggtaaagtt
atgttagtagacgattatggacaccacccaacggaagttgatgtgactattaaagcggct
cgtcaaggctgggaaaataaacgtattgtgatggtgtttcagccccatcgctattctcgt
actcgtgatttatttgatgattttgtacaggtattatcgcaagtggatgcgctaattatg
ctgaatgtttatgctgctggagaaagcccgattattggcgcggaaagtaaagatctgtgt
cgttcgattcgcaatcttggcaaagttgatccaattttggtttctgatgtttcgcagctt
ggtgaggtgttagatcaagtgatccaagatggtgatttggtattagcacaaggcgcaggt
aatgttagcaaactttctcgtgatttagcggaaagttggaaggcataa

DBGET integrated database retrieval system