KEGG   Bifidobacterium thermophilum: D805_0734Help
Entry
D805_0734         CDS       T02505                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
btp  Bifidobacterium thermophilum
Brite
KEGG Orthology (KO) [BR:btp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:btp01001]
    D805_0734
Enzymes [BR:btp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     D805_0734
Protein kinases [BR:btp01001]
 Serine/threonine kinases: Other
  Bacterial family
   D805_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like RIO1 Kdo Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AGH41001
UniProt: M4RC03
LinkDB All DBs
Position
complement(920768..923026)
Genome map
AA seq 752 aa AA seqDB search
MTETANEGQIIDDRYRIVRKIADGGMATVYEAIDVRLDRHVAVKVMHAQLAQGPHREQFV
ERFHREARSAAAIANPHIVQVYDTGEIDGRNYLVMEYVHGVNLRYEMNQQGPFTVRETLR
VVAETLDGLAAAHRAGVVHRDIKPENILLNDRGHVQITDFGLAKAASQATLSTTGMLLGT
AAYLAPEMIENNQATPQGDLYSVGIMAWEMLAGEPPFQSDNPVTMVFKHVHEDVPPVITR
CPGIEPSVSEFIAQLTARSVEDRPADAMEAQRLLRTVISGMPMEAWLYRRSDDPMRDEST
GDGESPLAPNGLVAPRGENGHDAAASTTSVAQSDYPPQPPAPSSPSSSAATSADMSPDTS
ATTPTDGRSGAANTQDTRTRILATDSNAARRPRSITSQDAFTQAITTTDTSDIEPSGVAE
HSRGGRPRSKVPIIVAAIMAVVLAAGAGCGAWWYYLGPGSYWTMPKPTDLTCKTGKTCTI
KNVSWSSFRSTLNVAGIPYSVAQEYSDTVEEGNIISTTPSTVGAHISKRSAGNVKVTVSK
GVRQATIPSDITDPSTDNGKDPLTALEKAGFTNISHNINDDEYSLTVPKNALLSISPDPG
TTMEHNDSVVVKLSLGPMPVNMPDVVGRTKDEAQALFDSLQLKATYSEEYSDTVPNGSII
SASQTVGTQLHWGDTVDVVVSKGPQMVTLPDVTGKSTSDATAALQALGLEVKVSAPLGDL
THTVRLQSPSAGQQVRVRDANGNKTVITLTVV
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaactgcgaacgaagggcagatcatcgacgaccggtaccgtatcgtgcgcaaa
atcgccgacggcggcatggcgaccgtgtatgaggcgattgatgtgcgtcttgaccggcat
gtcgctgtcaaagtgatgcatgcacagctggcgcaggggccgcatcgcgaacagttcgtg
gaacgattccatcgtgaggctcggtccgcggcggccattgcgaacccgcacatcgtccag
gtctacgacaccggggagattgacggccgcaactatctggtcatggaatacgtccatggc
gtcaatctgcgctatgagatgaaccagcagggtccgttcaccgtgcgcgagaccctgcgc
gtcgtcgcggagacgctggatgggcttgcagccgcgcatcgcgcaggcgtcgtgcaccgg
gatattaagccggagaacatcttgctcaacgaccgcggccatgtccagatcaccgatttc
gggctggcgaaggccgcgtcgcaggccacgctgtccacgacgggtatgctgttgggcacg
gcagcctatctggcaccggagatgatcgagaacaaccaggccacacctcagggcgacctg
tattcagtaggcatcatggcctgggagatgcttgccggtgagccgccattccagtcggat
aacccggtgacgatggtgttcaaacatgtgcacgaggacgttcccccggtgattacccgc
tgcccgggcatcgaaccgtccgtctctgaatttatcgcgcaactgacggcacgttcggtt
gaggacaggccagcggacgccatggaagcgcaacgactccttcgcacagtgatttccggg
atgccgatggaggcttggctgtaccggcggtcggacgatcctatgcgcgacgaatccact
ggcgacggcgaatccccgttggcgcccaacggtttggtcgccccgcgcggcgagaacggg
catgatgccgcggcatcaacaacgtcagtggcacagtcggattacccgccgcagccgcca
gcaccgtcgtcaccgtcgtcatccgcggcgacgtccgccgacatgtcccccgacacatct
gccacaacaccaacggatgggcgttccggcgccgctaacacgcaggatacgcgtacccgc
atccttgcaaccgactcgaacgccgcaaggaggccgcgcagcatcaccagccaggacgcc
ttcacccaggcgatcaccacaaccgacacatcggatatcgagccttccggcgtcgcggag
cattcccgtggcgggcggccacgcagcaaggttccaatcatcgtcgccgccattatggcc
gtcgtgcttgccgccggcgcaggatgcggcgcatggtggtattatctgggccccggcagc
tactggaccatgccgaaacccactgatctgacatgcaaaacaggcaagacctgcaccatc
aagaatgtcagctggagctcgttccgcagcacgctcaacgttgccggaatcccttattcc
gtcgcccaggaatacagcgataccgtcgaagagggcaacatcatctcaaccacgccgtcc
acggtcggcgcgcatatcagcaaacgcagcgcgggcaatgtgaaagtcaccgtgtccaaa
ggcgtgcggcaggcgaccattccctcagacatcaccgacccatcgaccgacaacggcaag
gaccccctgaccgccctcgaaaaggctggcttcacgaacatttcgcataatatcaacgat
gacgagtattcgctgaccgttccaaagaacgccctgctgagcatctcccccgaccctggc
accacgatggaacataacgacagcgtggtggtgaaactctccttgggaccgatgccggtc
aatatgccggatgtcgtcggcagaaccaaagacgaggcgcaggccttgttcgacagcttg
cagctcaaggccacctacagcgaggaatatagcgataccgtgccaaacggcagcatcatc
tcggcatcacagacggtcggcacccaactgcactggggagacaccgtcgacgtcgtggtt
tccaagggcccacagatggtgacgctgcctgatgtaaccggcaaaagcaccagcgatgcg
actgcggccctacaggcgctcggtttggaggtgaaggtcagcgccccgctcggcgacctg
acccacaccgtgcggttgcagtcgccgtctgccggtcagcaggtgcgtgtccgggacgcg
aacggcaacaagactgtaatcacactgactgtggtgtga

DBGET integrated database retrieval system