KEGG   Bifidobacterium thermophilum: D805_0799Help
Entry
D805_0799         CDS       T02505                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
btp  Bifidobacterium thermophilum
Pathway
btp00330  Arginine and proline metabolism
btp01100  Metabolic pathways
btp01110  Biosynthesis of secondary metabolites
btp01130  Biosynthesis of antibiotics
btp01230  Biosynthesis of amino acids
Module
btp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:btp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    D805_0799
Enzymes [BR:btp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     D805_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AGH41066
UniProt: M4RC58
LinkDB All DBs
Position
1001833..1002300
Genome map
AA seq 155 aa AA seqDB search
MLAPGTHHLSIVPNTPIAAGKGVVVAENTHSLTDEEIVNFHSLFDPIALVEFLDTSMLYQ
AGTVTSCAPAYAAMFIEALSDAAVKHGIPRAAAYRLVSAMVEGTGALQVETGKIPAAMKD
AVCSPGGATIRGVEALELRGFHGDVMSAVDAVMGD
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgcccctggcacgcaccacctgtccatcgtgccgaacacgccgattgctgcaggc
aaaggcgttgtggtggcagagaacacgcatagtctcaccgacgaggaaatcgtcaatttc
cactcccttttcgaccccatcgcactcgtcgaattcctcgatacgtccatgctgtaccaa
gcgggcaccgtcaccagttgcgcgccggcgtacgcagccatgttcatcgaagcgctctcc
gatgccgcagtcaagcatggcattcctcgcgccgccgcataccgcttggtgtcggcgatg
gtggagggcacgggcgccttgcaggttgagacagggaagattccggctgcgatgaaggac
gccgtgtgctctcctggcggcgccacgatccgcggcgtggaagcgcttgaactgcgaggc
ttccacggggatgtgatgagtgccgtcgatgccgtcatgggcgactga

DBGET integrated database retrieval system