KEGG   Burkholderia thailandensis 2002721723: BTQ_1111Help
Entry
BTQ_1111          CDS       T03111                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
btq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:btq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTQ_1111
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btq02000]
    BTQ_1111
Enzymes [BR:btq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BTQ_1111
Transporters [BR:btq02000]
 Other Transporters
  Pores ion channels [TC:1]
   BTQ_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AHI72399
LinkDB All DBs
Position
1:1249410..1250066
Genome map
AA seq 218 aa AA seqDB search
MLRLCGFPVSNYYNKVKFVLIEHGIPFDETLVNVPIKDPACFADTPLGKVPYLLTERGAL
SESQAIVEYLAASHPDKRIFPADPFDAAKAREIMTVLELYVEWNARELFPEAFFGGKVSD
GTKAHVEERMPRALDGFKRLARFSPYVLGDTFCIADIAAFVHFPITALATKAIYGRDFIA
DAGIDWKSYVKRIEEERPAAKRVSEERKAFIAGLAKQG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgtgtggttttcccgtgtccaattactacaacaaggtcaagttcgtcctg
atcgagcacggcattccgttcgacgagacgctcgtcaatgtcccgatcaaggatcccgcg
tgcttcgccgacacgccgctcggcaaggtgccgtatctgctgaccgagcgcggcgcgctc
agcgaatcgcaggcgatcgtcgaatatctcgccgcgagccacccggacaaacgcattttc
ccggccgacccgttcgacgccgcgaaggcgcgcgagatcatgacggtgctcgagctgtat
gtcgaatggaacgcgcgcgagctgtttccggaggcattcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgaggagcgcatgccgcgcgcgctcgacggcttcaagcggctt
gcgagattctcgccttacgtgctcggcgatacgttctgcatcgccgacatcgccgcgttc
gtccattttccgatcaccgcgctcgcgacgaaggcgatttatggccgcgatttcatcgcc
gacgccgggatcgactggaagtcatacgtgaagcgcatcgaggaggagcggccggccgcg
aagcgagtgagcgaggagcgcaaggcgttcatcgcggggctggcgaagcagggttga

DBGET integrated database retrieval system