KEGG   Burkholderia thailandensis 2002721723: BTQ_3655Help
Entry
BTQ_3655          CDS       T03111                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
btq00020  Citrate cycle (TCA cycle)
btq00190  Oxidative phosphorylation
btq00650  Butanoate metabolism
btq01100  Metabolic pathways
btq01110  Biosynthesis of secondary metabolites
btq01120  Microbial metabolism in diverse environments
btq01130  Biosynthesis of antibiotics
btq01200  Carbon metabolism
Module
btq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
btq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:btq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTQ_3655
   00650 Butanoate metabolism
    BTQ_3655
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BTQ_3655
Enzymes [BR:btq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BTQ_3655
    1.3.5.4  fumarate reductase (quinol)
     BTQ_3655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_4 Fer4_18 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AHI76279
LinkDB All DBs
Position
2:complement(469383..470090)
Genome map
AA seq 235 aa AA seqDB search
MSNTRTFEIFRYDPDRDAKPYMQAYEIEVPAGDRMLLDVLVRLKAQDETLSFRRSCREGV
CGSDAMNINRKNGLACITNLNDLPRHTVLRPLPGLPVVRDLIVDMTAFFKQYHSIKPYLI
NDTPPPERERRQSPEERDQLDGFYECILCACCSSACPSYWWNPDKYVGPAGLLQAYRFLV
DSRDEGTGERLDNLDDPYRLFRCRTILNCTDVCPKGLNPARAISEIRTMLARRTI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaacaccagaacctttgaaatattccgctacgatccggacagggacgccaaaccg
tacatgcaggcgtacgagatagaggtgcccgccggcgaccggatgttgctcgacgtactc
gtccgcctcaaggcacaggacgaaacgctgagctttcggcgttcgtgtcgcgaaggcgta
tgcggttcggatgcgatgaacatcaaccgcaagaacgggcttgcctgcatcaccaacctg
aacgacctcccccgccacacggtcctgcgtccgctgcccgggttgccagtcgttcgcgac
ctgatcgtggacatgaccgcgttcttcaagcagtaccactcgatcaagccctatctgatc
aacgacactccgccgcccgaacgggaaaggcgccagtcgcccgaggagcgcgatcaactc
gacggtttctatgagtgtattttgtgcgcgtgctgttccagcgcgtgcccctcgtactgg
tggaatccggacaaatatgtcggccctgcaggcctgctgcaagcctatcgctttctggtc
gattcccgcgacgagggcacgggcgagcgacttgacaatcttgacgatccgtatcgcctc
ttccggtgtcggacgatactgaactgcaccgatgtctgtccgaaggggttgaacccggcc
agggcaatctccgagatccggaccatgcttgcgcgccggacgatctga

DBGET integrated database retrieval system