KEGG   Burkholderia thailandensis 2002721723: BTQ_402Help
Entry
BTQ_402           CDS       T03111                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
btq00550  Peptidoglycan biosynthesis
btq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTQ_402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:btq01002]
    BTQ_402
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btq01011]
    BTQ_402
Enzymes [BR:btq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BTQ_402
Peptidases [BR:btq01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BTQ_402
Peptidoglycan biosynthesis and degradation proteins [BR:btq01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BTQ_402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AHI74325
LinkDB All DBs
Position
1:443402..444712
Genome map
AA seq 436 aa AA seqDB search
MRLSSLGLTSLASSTAIAVAARNVALGIVLPAALVSTIAVAQAKPAAKAKHAAAPAAAAP
TGAPATYAPGAVPPPGVNARSWVLVDASSNQVLASGNADERVEPASLTKLMTAYLVFEAL
DAKKITMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLVYGMIIQSGNDAAIALAELV
GGSEAQFVNMMNAEAQRLGMKNTHFADVNGMPDPNHYTTAGDLATLSTHLIRDYPDYYNI
FSVKEFTYNNIKQPNRNRLLWLDPTVDGLKTGHTQAAGYCLIASAKRSLPGAADATRRLV
TVMMGETKESDRVQDSMKMLNYGYTAFDSVRLYKAGQPIDTPRVYKGKSNNVQVGVKKDQ
FITVPRGLADKVKPEVALNAPLIAPLADGQAVGSVKLVADGKTVAEFPVVALQPVPEAGL
LGRIWDSILLMFSKKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgtcttccctcggcctcacgtcactcgcttcctccaccgccattgccgtcgcc
gcgcgcaacgtcgcgctcggcatcgtgctgcccgccgcgctcgtgtcgacgatcgccgtc
gcgcaggcgaagcccgccgccaaggcgaagcacgcggccgcgccggccgccgccgcgccg
acgggcgcgcccgccacttatgcgccgggcgccgtgccgccgccgggcgtgaacgcgcgc
tcgtgggtgctcgtcgacgcgtcgagcaaccaggtgctcgcctccggcaacgcggacgag
cgcgtcgagccggcgtcgctcacgaagctgatgacggcctacctcgtgttcgaggcgctc
gacgcgaagaagatcacgatggagcagatcgtcacgccgagcgaggcagtgcgccgcgtc
ggccgcgacgagtcgcggatgttcatcgaggcgaacaagcccgtcagcgtgcacgatctc
gtctacgggatgatcatccagtcgggcaacgacgcggcgatcgcgctcgccgagctcgtc
ggcggcagcgaggcgcagttcgtcaacatgatgaacgctgaagcgcagcgcctcgggatg
aagaacacgcacttcgccgacgtgaacggcatgcccgacccgaaccactacacgacggcg
ggcgatctcgcgacgctgtcgacgcacctgatccgcgactatccggattactacaacatc
ttctcggtcaaggaattcacgtacaacaacatcaagcagccgaaccgcaaccggctgctg
tggctcgatccgaccgtcgacggcctgaagaccggccacacgcaggcggccgggtactgc
ctgatcgcgtcggcgaagcgttcgctgccgggcgcggccgatgcgacgcgccgcctcgtc
acggtgatgatgggcgagacgaaggagagcgaccgcgtgcaggacagcatgaagatgctg
aactacggctacaccgcgttcgattcggtgcgcctgtacaaggccggccagccgatcgac
acgccgcgcgtctataagggcaagagcaacaacgtgcaggtcggcgtgaagaaggaccag
ttcatcaccgtgccgcgcggcctggcggacaaggtgaagccggaagtcgcgctgaacgcg
ccgctcatcgcgccgctcgcggacggccaggcggtcggctcggtgaagctcgtcgccgac
ggcaagacggtggcggaattcccggtcgtcgcgctgcagccggtgcccgaggcgggcctg
ctcggccgcatctgggattcgatcctgctgatgttcagcaaaaagaagtaa

DBGET integrated database retrieval system