KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-190: F544_5790Help
Entry
F544_5790         CDS       T03019                                 

Definition
(GenBank) Penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
btra  Bibersteinia trehalosi USDA-ARS-USMARC-190
Pathway
btra00550  Peptidoglycan biosynthesis
btra01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:btra00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F544_5790
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    F544_5790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btra01011]
    F544_5790
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:btra03036]
    F544_5790
Enzymes [BR:btra01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     F544_5790
Peptidoglycan biosynthesis and degradation proteins [BR:btra01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   F544_5790
Chromosome and associated proteins [BR:btra03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    F544_5790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHG85811
UniProt: W0R4Y3
LinkDB All DBs
Position
598152..600203
Genome map
AA seq 683 aa AA seqDB search
MKKSIKPKKAALAENSAEHQANGKAKASFLPIRFGIIYLLLGLMAVGLLAQSFYLQVVDS
ERLIEEANKRSIRTEQLPFTRGKILDRNGQILSVSVPMHSITMDPKEYFDDKLRKDRARW
RQLSREIGVSQSKMEAAVNNFIKQKQAKGEPKKYDPRALFNAKSEDYWTLLARSSGADYN
LLINNVRNNPQSEFLRLEYESIHKETEKLQALAKQSGKKYNELLDLLYKRSNDRFVYVAR
HLEEEIADYIKKLRIVGIVVKVEPRSVYPLAEITAQLVGYTNKEGVGRDARQGIPLAEQD
NGAGIEYSFNDMLMGKDGKKVVRRDRNRNVVGLLQEQKAFDPNDLELSIDAELQSMAYEE
IKRAVAENKAESGTAVLVDIQTGEILAMANAPSFNPNDPNRKGFATAAARNRAITDTFEP
GSTVKPLVVLTALDEKVTYKDEIINTRPFTVGGHTIRDVAPRESLSLTGILQKSSNIGVS
RLALRMPPEVLVGTYKKVGFGKETGLGLGGEVKGSSGERKRWAESEKVAISYGYGLSVTP
VQLARAYATLGSFGIYRPLSITKVDPPVIGERVLPEKTTRDVVKMMESVAQPGEGGARTM
VDGYRVAVKTGTARKLENGKYVKKHLAYAAGIAPASDPRYALVVLINEPKAGNYYGGAVS
APLFSKIMGYTLKSQNVRPDNLK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagcatcaaacctaaaaaagcagccctagctgaaaatagtgcagagcatcag
gcaaatggaaaagccaaagcgagttttttaccgattcgctttggcattatctatttatta
ttaggcttgatggcagttggtttactagcacagagtttctatttgcaggtagttgattcg
gaacgtttaattgaggaggcgaataaacgttctattcgtacagagcaattgccgtttact
cgtggcaaaattttggatcgtaatgggcaaattttgtctgtaagtgtgcctatgcactca
attacaatggatccaaaagagtattttgacgacaaattacgtaaagatcgtgctagatgg
agacaactttcgcgtgaaatcggtgtttctcagagcaaaatggaagcagcggttaataat
tttattaaacaaaagcaagcgaaaggcgaaccgaaaaaatatgatccgagagcgttgttt
aatgccaaaagtgaagattactggacgctattagctcgctcaagtggggctgattacaat
ttattgatcaacaatgtacgtaataatccgcagtcagaatttttgcgtttggaatatgaa
tcgatccacaaagaaactgaaaaattacaggcattagcgaaacagagtggcaaaaaatat
aacgaattattagatttactttacaaacgttctaatgatcgctttgtttatgtggcacgc
catttagaagaagaaatagcggattacatcaaaaaattacgcattgttgggattgtggtt
aaagttgaaccaagaagcgtgtatccccttgctgaaattaccgctcaacttgtaggctac
acaaacaaagaaggggtggggcgagacgctcgtcagggtattccactcgccgagcaagat
aacggtgcagggatcgaatatagcttcaacgatatgttgatggggaaagacggcaaaaaa
gtagtacgtcgtgaccgtaatcgtaatgtagtgggcttattgcaagagcaaaaagctttt
gatccaaatgatttagagttaagtattgatgctgaattgcaatcaatggcttatgaagaa
attaaacgtgcggtggcggaaaataaagcggaatcaggtacagcagtgctggtggatatt
caaacgggggaaattttagcgatggcaaatgccccatcgttcaacccaaatgatccaaac
cgtaaaggctttgcgaccgcagctgctcgtaaccgtgcaattacagatacttttgaaccg
ggttcaacagttaaacccttagtggttttaaccgcacttgatgaaaaagtgacttacaaa
gatgagattatcaacacccgtccatttactgttggtgggcatacgattagagatgttgcc
ccacgtgaaagtttaagtttgacagggattttgcaaaaatcgagtaacatcggcgtgagc
cgtttagcattgagaatgccaccagaagtgttagtaggcacttataaaaaagtaggtttt
ggcaaagaaacaggcttaggcttaggcggtgaagtaaaaggctcaagtggtgagcgtaag
cgttgggctgaaagcgaaaaagtggcaatttcctatggctatggtttaagtgttacccca
gtacaacttgcacgagcctatgcaaccttaggcagttttgggatctatcgtccactttct
attaccaaagtcgatcccccagtgattggtgagcgagttttgccagaaaaaaccacccgt
gatgtggtaaaaatgatggaaagtgtcgctcaaccgggggaaggtggtgcgagaacgatg
gttgatggctaccgagtagcggttaagacaggtacggctcgtaagctagaaaatggtaaa
tatgtaaaaaaacaccttgcttacgccgcagggatcgcaccagcaagcgacccacgttat
gcattggtagtgttaattaatgagccaaaagcaggaaattactacggtggtgcggtatcc
gccccactcttttctaaaattatgggctataccctgaaaagccagaatgtgagacctgat
aatttaaaataa

DBGET integrated database retrieval system