KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-190: F544_5890Help
Entry
F544_5890         CDS       T03019                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
btra  Bibersteinia trehalosi USDA-ARS-USMARC-190
Pathway
btra00473  D-Alanine metabolism
btra00550  Peptidoglycan biosynthesis
btra01100  Metabolic pathways
btra01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    F544_5890
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F544_5890
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    F544_5890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btra01011]
    F544_5890
Enzymes [BR:btra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     F544_5890
Peptidoglycan biosynthesis and degradation proteins [BR:btra01011]
 Precursor biosynthesis
  Amino acid ligase
   F544_5890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 R2K_2 GARS_A ATPgrasp_Ter CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AHG85821
UniProt: W0R4Z2
LinkDB All DBs
Position
612730..613641
Genome map
AA seq 303 aa AA seqDB search
MSLKQEKIAVLYGGVSSEREVSLASGQAIYEALKGLGYNVEAIDTKEFPVEKLKERGIQR
VFNILHGGIGENGVLQGALEQMGIKYTGCGVMASAVTLDKFRTKLLWQAVGLPTAEMVVV
QRGQAVNASEIIAKLNLPVFVKPASEGSSVGVTKVKTEAELLPAIEEALKFDSLVLVEAF
LAGAEYSVPVLDGEVLPAVQIIPEGEFYDYHAKYISDNTQYVVPALNAERQAEVAELVKK
AYDVVGCHGWSRIDVMEDARGKFNLVEVNTCPGMTSHSIFPKSAATVGYSFEQLVEKVLE
LSA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaaacaagaaaaaatcgcagtgttatatggtggtgtttctagcgaacgtgaa
gtttcgctggcatctggtcaagcaatttatgaagcattgaaaggattaggctataacgtt
gaagcgattgataccaaagaatttccagttgaaaaattaaaagagcgtggcattcaacgt
gtgtttaacattttacacggtggtatcggcgaaaacggtgtattacaaggtgcattagaa
caaatgggtatcaaatatactggttgtggcgtaatggcatcggcggtgactttggataaa
ttccgcacaaaattattatggcaagcggtaggtttaccaaccgctgaaatggtggttgta
cagcgtggacaagcggttaatgcttcggaaattattgcaaaattaaatttacctgtgttt
gtgaaaccagcaagcgaaggttctagtgttggtgttaccaaagtaaaaaccgaagcggaa
ctattacctgcgattgaagaagcattgaaatttgatagccttgtgttggtagaagcattt
ttagcaggtgcggagtattctgtaccagtgcttgatggtgaagtattgcctgcagttcaa
attattccagaaggcgaattttacgactatcatgcaaaatatatttcagataacacccaa
tatgttgtgcctgcacttaatgcagaacgtcaagcggaagtagcggaattagtgaaaaaa
gcctatgacgttgtcggttgtcatggctggagtcgtattgatgtgatggaagatgcaaga
ggtaaatttaacttggtggaagtgaatacttgccctggtatgacgagccacagtattttc
cccaaatccgcggcaacagtgggttatagctttgagcaattagttgaaaaagtgttggag
ttaagtgcgtaa

DBGET integrated database retrieval system