KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-188: F542_11160Help
Entry
F542_11160        CDS       T03017                                 

Definition
(GenBank) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
btre  Bibersteinia trehalosi USDA-ARS-USMARC-188
Pathway
btre00061  Fatty acid biosynthesis
btre00780  Biotin metabolism
btre01100  Metabolic pathways
btre01130  Biosynthesis of antibiotics
btre01212  Fatty acid metabolism
Module
btre_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:btre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    F542_11160
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    F542_11160
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    F542_11160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:btre01004]
    F542_11160
Enzymes [BR:btre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     F542_11160
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     F542_11160
Lipid biosynthesis proteins [BR:btre01004]
 Fatty acid synthase
  Component type
   F542_11160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF4570
Motif
Other DBs
NCBI-ProteinID: AHG81834
UniProt: A0A4V7I9Y5
LinkDB All DBs
Position
1193254..1194036
Genome map
AA seq 260 aa AA seqDB search
MSFLAGKRILITGLASNRSIAYGIAKAMKAQGAELAFTYLNDKLKARVEEFATEFGSDIV
LPMDVAFDDSITNCFAELSKKWEKFDGFVHSIGFAPGDQLDGDYVNAATREGFRIAHDIS
AYSFVAMAQAARPYLNPNSALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADMGKD
GIRVNAISAGPIRTLAASGIKDFKKMLSSFEKTAPLRRCVTIDDVGNSAAFLCSDLAGGI
TGEVVHVDAGYSTVAMGDIE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagctttttagcaggtaaacgtattttaatcactggcttagccagcaaccgttctatt
gcttacggcattgccaaagcaatgaaagcacaaggtgcagagctggctttcacctactta
aatgataaattgaaagctcgcgtggaagaatttgcaactgaatttggttcagacattgtt
ttaccaatggatgtggcatttgatgatagcatcacgaattgttttgctgaacttagcaaa
aaatgggaaaaatttgatggttttgtgcattctatcggctttgctcctggcgatcagctc
gatggcgattatgtaaacgctgcaacccgcgaaggtttccgtattgcgcacgatattagt
gcatatagttttgtagcaatggcacaagctgctcgcccatacttaaatccaaattcggca
cttttaacgctgtcttatttaggtgcagaacgtgcaattccaaactacaatgtaatgtgc
ttggcaaaagcgtctcttgaagcagcaactcgtgtgatggctgccgatatggggaaagat
ggtattcgtgtcaatgcgatttccgcaggcccaatccgcactcttgctgcaagtggtatc
aaagacttcaagaaaatgttgtctagctttgaaaaaactgctccattacgccgttgtgta
accattgatgatgtgggtaattctgcggcattcctatgttctgatttagcaggcggtatc
actggcgaagtcgtacacgttgatgctggttatagcacagtagcgatgggtgatattgaa
taa

DBGET integrated database retrieval system