KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-188: F542_9400Help
Entry
F542_9400         CDS       T03017                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
btre  Bibersteinia trehalosi USDA-ARS-USMARC-188
Pathway
btre00240  Pyrimidine metabolism
btre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    F542_9400
Enzymes [BR:btre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     F542_9400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 DUF2075 AAA_14
Motif
Other DBs
NCBI-ProteinID: AHG81658
LinkDB All DBs
Position
complement(969284..969862)
Genome map
AA seq 192 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSAYNYQERGMRPLVYTAAIDDRYGVGKVASRIGISQQAN
LFDKNSDLFAEISQEHHKQTLHCILVDEAQFLTKQQVYQLSEVVDKLGIPVLCYGLRTDF
QAELFEGSRYLLAWADQLEELKTICYCGRKANFVIRLNQHGEVVKDGEQIQIGGNDSYLS
VCRRHYKEKLAK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattatacttctactattcctcaatgaatgcagggaaatccacaaccctactt
caatctgcttataactatcaagaacgtggcatgcgcccgttggtatatacagcagcaatt
gatgatcgctacggcgtaggcaaagttgcctcacggattggtatatcccaacaggcaaat
ctttttgataaaaattcagacctcttcgctgaaattagccaagaacaccacaaacaaaca
ttgcattgtatcttggtggatgaggctcaatttctcaccaaacaacaggtatatcaatta
agtgaagttgtagataaattaggtatccctgttctttgctatggactacgcactgatttc
caagcagagctttttgaaggaagccgttatctcttagcttgggcagatcaattagaagag
ctgaaaactatctgttattgtgggcgcaaagcaaattttgtgatacgtttaaatcaacat
ggcgaagtggttaaagatggtgaacaaattcaaattggcggcaatgatagctacctgtct
gtttgtcgccgacactataaggaaaagttagctaaataa

DBGET integrated database retrieval system