KEGG   Bordetella trematum: SAMEA390648700547Help
Entry
SAMEA390648700547 CDS       T04322                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
btrm  Bordetella trematum
Pathway
btrm00473  D-Alanine metabolism
btrm00550  Peptidoglycan biosynthesis
btrm01100  Metabolic pathways
btrm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAMEA390648700547 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAMEA390648700547 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SAMEA390648700547 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btrm01011]
    SAMEA390648700547 (ddl)
Enzymes [BR:btrm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SAMEA390648700547 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:btrm01011]
 Precursor biosynthesis
  Amino acid ligase
   SAMEA390648700547 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 TTL ATP-grasp ATPgrasp_ST CPSase_L_D2 RimK ATPgrasp_Ter ATPgrasp_YheCD ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: SAI67022
UniProt: A0A157P6Z8
LinkDB All DBs
Position
1:complement(582239..583192)
Genome map
AA seq 317 aa AA seqDB search
MTQKFGKVGVLYGGRSAEREVSLMSGAGVHEALLSAGVDAHLFDTGTQSLAQLEAEGFER
VFLALHGRYGEDGSLQGALELLDIPYTGSGVTASALAMDKILTKRVWLQQGLPTPAFEAL
EGPQGLRETAERLGLPLILKPPHEGSTVGVTKVTEFSALEQAYADAAVFDDAVLAEQFVR
GRELTVAVLGSGRAARALPVIEIVAPDGNYDYQNKYFTDVTQYHCPADLPPGVAAKTEAI
AVQAYRALGCEGWGRADFMLDENHQPWLLEMNTSPGMTSHSLVPMAARAVGMSYAELCVA
ILAEASCKLRAPARANG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaagtttggcaaggtcggggtgctttacggcggccgttccgccgagcgcgaa
gtgtcgctgatgtccggcgcgggggtgcacgaagccctgttgagcgccggtgtggacgcg
catctgttcgataccggcacgcaaagcctcgcccagctggaggccgaagggttcgagcgg
gtattcctggcgctgcatggccgctatggtgaagacggcagcctgcagggcgcgctcgaa
ctgctcgacattccctataccggcagcggcgtgaccgcttcggccctggcgatggacaag
attctcaccaagcgggtctggttgcagcaaggtctgcccacgccggcttttgaggccctc
gaggggccgcagggcctgcgcgaaaccgctgagcgcctcggcctgccgctgattctcaag
ccgccgcacgaagggtcgaccgtcggcgtgaccaaagtgaccgagttttccgcgctggag
caggcctacgccgacgccgccgtgttcgatgacgccgtgctggccgagcaattcgtgcgc
ggccgggagctgacggtggccgtgctgggcagcgggcgcgcggcgcgcgccctgccggtg
atcgagatcgtggcgcctgacggcaattacgactaccagaacaagtatttcaccgatgtg
acccaataccattgcccggccgatctgccgccgggcgtggcggccaagaccgaagcgatc
gccgtccaggcctatcgtgccctgggttgcgaaggctgggggcgcgccgacttcatgctc
gatgaaaaccaccagccctggttgctggaaatgaacacctcgcccggcatgaccagccat
tcgctggtgccgatggcggcccgtgcggtcggcatgagttacgcagagctgtgcgtggcc
atcctggccgaggccagttgcaagctgcgcgcaccggcgcgcgccaatggatag

DBGET integrated database retrieval system