KEGG   Bordetella trematum: SAMEA390648700547Help
Entry
SAMEA390648700547 CDS       T04322                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
btrm  Bordetella trematum
Pathway
btrm00473  D-Alanine metabolism
btrm00550  Peptidoglycan biosynthesis
btrm01100  Metabolic pathways
btrm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAMEA390648700547 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAMEA390648700547 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SAMEA390648700547 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btrm01011]
    SAMEA390648700547 (ddl)
Enzymes [BR:btrm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SAMEA390648700547 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:btrm01011]
 Precursor biosynthesis
  Amino acid ligase
   SAMEA390648700547 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 TTL ATP-grasp ATPgrasp_ST CPSase_L_D2 RimK ATPgrasp_YheCD ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: SAI67022
UniProt: A0A157P6Z8
LinkDB All DBs
Position
1:complement(582239..583192)
Genome map
AA seq 317 aa AA seqDB search
MTQKFGKVGVLYGGRSAEREVSLMSGAGVHEALLSAGVDAHLFDTGTQSLAQLEAEGFER
VFLALHGRYGEDGSLQGALELLDIPYTGSGVTASALAMDKILTKRVWLQQGLPTPAFEAL
EGPQGLRETAERLGLPLILKPPHEGSTVGVTKVTEFSALEQAYADAAVFDDAVLAEQFVR
GRELTVAVLGSGRAARALPVIEIVAPDGNYDYQNKYFTDVTQYHCPADLPPGVAAKTEAI
AVQAYRALGCEGWGRADFMLDENHQPWLLEMNTSPGMTSHSLVPMAARAVGMSYAELCVA
ILAEASCKLRAPARANG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaagtttggcaaggtcggggtgctttacggcggccgttccgccgagcgcgaa
gtgtcgctgatgtccggcgcgggggtgcacgaagccctgttgagcgccggtgtggacgcg
catctgttcgataccggcacgcaaagcctcgcccagctggaggccgaagggttcgagcgg
gtattcctggcgctgcatggccgctatggtgaagacggcagcctgcagggcgcgctcgaa
ctgctcgacattccctataccggcagcggcgtgaccgcttcggccctggcgatggacaag
attctcaccaagcgggtctggttgcagcaaggtctgcccacgccggcttttgaggccctc
gaggggccgcagggcctgcgcgaaaccgctgagcgcctcggcctgccgctgattctcaag
ccgccgcacgaagggtcgaccgtcggcgtgaccaaagtgaccgagttttccgcgctggag
caggcctacgccgacgccgccgtgttcgatgacgccgtgctggccgagcaattcgtgcgc
ggccgggagctgacggtggccgtgctgggcagcgggcgcgcggcgcgcgccctgccggtg
atcgagatcgtggcgcctgacggcaattacgactaccagaacaagtatttcaccgatgtg
acccaataccattgcccggccgatctgccgccgggcgtggcggccaagaccgaagcgatc
gccgtccaggcctatcgtgccctgggttgcgaaggctgggggcgcgccgacttcatgctc
gatgaaaaccaccagccctggttgctggaaatgaacacctcgcccggcatgaccagccat
tcgctggtgccgatggcggcccgtgcggtcggcatgagttacgcagagctgtgcgtggcc
atcctggccgaggccagttgcaagctgcgcgcaccggcgcgcgccaatggatag

DBGET integrated database retrieval system