KEGG   Bordetella trematum: SAMEA390648700767Help
Entry
SAMEA390648700767 CDS       T04322                                 

Gene name
argJ
Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
btrm  Bordetella trematum
Pathway
btrm00220  Arginine biosynthesis
btrm01100  Metabolic pathways
btrm01110  Biosynthesis of secondary metabolites
btrm01130  Biosynthesis of antibiotics
btrm01210  2-Oxocarboxylic acid metabolism
btrm01230  Biosynthesis of amino acids
Module
btrm_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAMEA390648700767 (argJ)
Enzymes [BR:btrm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     SAMEA390648700767 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     SAMEA390648700767 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ LptE
Motif
Other DBs
NCBI-ProteinID: SAI67498
UniProt: A0A157QHB7
LinkDB All DBs
Position
1:817045..818271
Genome map
AA seq 408 aa AA seqDB search
MAVNLQIPSESAIYPVAGVEIGVTEAGIRKANRRDLTVFRLAPGATVAGVFTRNRFCAAP
VQVCQAHLALGGPIRALVINTGNANAGTGEPGLENARATCAGLARLLDIPAEQVLPFSTG
VILEPLPMDRLLAGLPKAVAALGDNQWFNAAHGIMTTDTLPKIHSRRLTLGGKTITITGI
SKGAGMIRPNMATMLSFLATDAGIAQPLMNTLARELADQSFNRITIDGDTSTNDSFIVVA
TGQSGLQIDSDSHPDYAALRAALVEAAADLAQKIVRDAEGATKFMTIRVEEAGSVDEALK
VAYAVAHSPLVKTAFYASDPNLGRILAAIGYAGIDDLDTNALRLWLDDVLVARDGGRNPD
YQEADGQRVMQQAEILVRIALGRGQITETVYTCDFSHEYVSINADYRS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaacctccagattccctccgaatccgcaatttatcccgtcgccggtgtcgag
atcggcgtgaccgaagccggtatccgcaaggccaaccgacgcgacctgaccgtgttccgc
ctggcgccaggcgccaccgtggcgggcgtgttcacgcgcaaccgcttctgcgccgcgccg
gtgcaggtctgccaggcccacctggccctgggcggcccgatccgcgcgctggtgatcaac
accggcaacgccaacgccggcaccggcgagccgggtctggaaaacgcccgcgccacctgc
gccgggctggccaggctgctggacatcccggccgagcaggtgctgccgttctccaccggc
gtcatcctggagcccctgcccatggatcgactgctggccggcctgcccaaggccgttgcc
gcgctgggcgacaaccaatggttcaatgccgcgcacggcatcatgaccaccgacaccctg
cccaagatccattcgcgccgcctgaccctcggcggcaagaccatcaccatcaccggcatc
agcaagggcgccggcatgatccggcccaacatggccaccatgctcagcttcctggccacc
gacgccggcatcgcccagccgctgatgaacacgctggcgcgcgaactggccgaccagtcg
ttcaatcgcatcaccatcgacggcgacacctcgaccaacgattccttcatcgtggtcgca
acgggtcaatcgggcctgcagatcgatagcgacagccaccctgactacgccgcgctgcgc
gccgccctggtcgaggccgccgccgacctcgcacagaagatcgtgcgtgacgccgagggc
gccaccaagttcatgaccatccgcgtcgaagaagccggcagcgtcgacgaggccctcaaa
gtcgcttatgccgtggcgcactcgccgctggtcaagaccgccttctacgcctccgatccc
aacctgggtcgcatcctggcggccatcggctatgccggcatcgacgacctggacaccaac
gcgctgcgcctgtggctggacgacgtgctggtggcccgcgacggcgggcgcaacccggac
taccaggaggccgacggccagcgcgtgatgcagcaagccgagatcctggtgcgcattgca
ctgggccgcggccagatcaccgaaaccgtttacacctgcgacttctcgcacgagtacgtc
agcatcaacgccgactaccgttcctga

DBGET integrated database retrieval system