KEGG   Bordetella trematum: SAMEA390648701102Help
Entry
SAMEA390648701102 CDS       T04322                                 

Gene name
gatA_2
Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
btrm  Bordetella trematum
Pathway
btrm00970  Aminoacyl-tRNA biosynthesis
btrm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAMEA390648701102 (gatA_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:btrm03029]
    SAMEA390648701102 (gatA_2)
Enzymes [BR:btrm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SAMEA390648701102 (gatA_2)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SAMEA390648701102 (gatA_2)
Mitochondrial biogenesis [BR:btrm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SAMEA390648701102 (gatA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: SAI68133
UniProt: A0A157SD21
LinkDB All DBs
Position
1:complement(1167656..1169002)
Genome map
AA seq 448 aa AA seqDB search
MLPTLHQQRDALREKRVTSLSLTEAALARAQDEAGEGARVFTRLYAAAALAEARAADLLR
AAGIERSAIDGLPISIKDLFDVRGEPTLSGSIARRAEAPASADAEVVRRLRAAGAVIVGK
TNMSEFAYSGLGLNPHYGTPANPWDRASGRIPGGSSSGAAVSVSDGMAVAAIGSDTGGSV
RIPSALCGLTGFKPSAQRVSMQGVLPLSASLDSIGPLAASVRCCITLDAILSGEPSDAVQ
PLPLAGLRLAVPATVALDDLDAEVSQAFEAALARLSRAGVRIESLAIPEFAELADINAQG
GFTAAEAYAWHRELLQRQGERYDPRVRTRILRGQAISAADYLDLLQRRRDWIAAVQARIA
PFDALAMPTTAGIAPPIAPLAADDALFAATNMRMLRNCTFINFLDGCALSLPCHAPGSAP
VGLMLAGANGSDRRMLAIGLAVEAALAA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgaccttgcatcaacaaagggatgcgctgcgcgagaagcgcgtgacctcgctt
tcgctgaccgaggccgcgctggcgcgtgcccaggatgaggcgggcgaaggcgcccgtgtc
tttacccgactgtatgccgcggcagcgttggccgaggcgcgtgccgccgatctgctgcgc
gcggccggcatcgagcgctcggccatcgacggcttgccgatcagcatcaaggacctgttc
gatgtgcgtggcgagccgacgctctcgggatcgatcgcgcgtcgggccgaagcgccggcc
agtgccgatgccgaggttgtgcggcgcctgcgcgccgcgggcgccgtcatcgtgggcaaa
accaatatgtccgagttcgcctactcgggcctgggcctgaacccgcactatggcacgccg
gccaacccctgggatcgcgccagcggccgcatcccgggcgggtcctcgtcgggcgcggcg
gtgtcggtcagcgacggcatggcggtggcggcgatcggctcggacaccgggggatcggtg
cgtattccgtcagccctgtgcgggctgaccggtttcaagcccagcgcgcagcgcgtctcc
atgcagggcgtgctgccgctgtcggccagcctggattccattggcccgctggccgccagc
gtgcgctgctgcatcacgctggatgccattctgtcgggcgagcccagcgatgccgtccag
ccgctgccgctggccggcctgcgcctggcggtgcccgccaccgtcgcgctcgatgacctc
gatgccgaggtgtcgcaggctttcgaggcggcgctggcgcgcctgtcgcgcgccggcgtg
cgcatcgaatcgctggccatccccgagttcgccgagctggccgatatcaatgcccagggc
ggcttcaccgccgccgaggcctatgcctggcaccgcgagctgctgcagcgccagggcgaa
cgctacgatccgcgcgtgcgcacgcgcatcctgcgcgggcaggcgatctcggcggccgac
tacctcgatctgctgcaacgtcgccgcgactggatcgcggctgtgcaggcgcgtatcgcg
ccctttgatgccctggcgatgccgaccaccgcagggatcgcgccgccgatcgcgcctctg
gcggccgacgacgcgctgttcgccgcgaccaacatgcgcatgctgcgcaactgcaccttc
atcaatttcctcgatggttgcgccctgtcgctgccctgccatgcgccaggcagcgcgccg
gtgggcctgatgctggccggcgccaacggcagcgatcgtcgcatgctggccattggcctg
gccgtggaggcggcgctggcggcatga

DBGET integrated database retrieval system