KEGG   Bordetella trematum: SAMEA390648701557Help
Entry
SAMEA390648701557 CDS       T04322                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
btrm  Bordetella trematum
Pathway
btrm00620  Pyruvate metabolism
btrm00680  Methane metabolism
btrm01100  Metabolic pathways
btrm01120  Microbial metabolism in diverse environments
btrm01200  Carbon metabolism
Module
btrm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMEA390648701557 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SAMEA390648701557 (ppc)
Enzymes [BR:btrm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SAMEA390648701557 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: SAI68875
UniProt: A0A157RWA6
LinkDB All DBs
Position
1:complement(1631964..1634792)
Genome map
AA seq 942 aa AA seqDB search
MNATRAQSDLAEPLRNDIRLLGRYLGTVIQACEGKRVFDTIETLRRSAVRFRREGRQDDG
ELMQQRVKQLRGSDPNLVARAFGYFLQLYNIAEDRDQNRNQRARALDDTAPAPGSLRHAI
DLLGSQGVPPQRIRSLLADACVMPVLTAHPTEVQRKSTLDEHRDIAALIAQRDQPLTAEE
AEEIDAALLGHIDTLWQTRMLRYTRLTVADEIENALSYYRSTFLSAVPRLYGDLARLLTP
DSKHPFAPPPAPLEPFLRMGSWIGGDRDGNPNVDADTLELAVLRQATVLFEHYLGQVHAL
STELSITRLLINASDELRQLAEASGDTSPHRRDEPYRRALLGIYARLAATARTLIGRELA
RRTPLPAEPYAHPQELARDLAVVADSLAQNNGAPIAKLRLTGLQQAIEVFGFHLATLDLR
QSSDVHERVLTELFARAGHPEAYDQLDEEARVALLRQELATGRPLASPWIEYSDETTREL
GVLRAAAAARARFGKPAVRQTIVSHTETLSDLLEVLVLQKETGLIDPASPQPEDGLMVVP
LFETIPDLERGPAIMAAWLDLPEVSARVRLAQGQTQEVMLGYSDSNKDGGYLTSNWALYR
AERELVDVFRARKVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQLRLTEQGEVIQT
KYKDAEIGRRNLELLVSAVLESSLAQQPAARQAEDAHMAHHGQTMDFLSEAAQRSYRELV
YETPGFSEYFFASTPILEIADLNIGSRPASRKQGQRIDDLRAIPWGFSWAQCRLMLTGWY
GVGSALEAYLEQGAPGAPRSKRARLAQLREMAQEWPAFRSLLSNMEMVLAKSDLAIASRY
AMLVPQRRVRERIFGAISEEHGRTLAMLKQVNQRELLADNPALAASLRERFAYIDPLNYL
QIDLIRRHRAAQRRPDATPDPRVPRAIHLTINGIAAGLRNSG
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctacacgcgcgcaatccgatcttgccgaaccgctacgcaacgacatccgcctg
ctcgggcgctacctgggcactgtcattcaagcctgcgaaggcaaacgggttttcgacacc
atcgagaccttgcggcgcagcgccgtgcgtttccggcgcgaaggccgccaggatgatggc
gaactgatgcagcagcgggtcaagcagctgcgcggcagcgaccccaatctggtggcgcgc
gccttcggctacttcctgcagctctacaacattgcggaagatcgcgaccagaaccgcaac
cagcgcgcccgcgcgctcgatgacacggcacccgcgccgggcagcctgcgccatgccatc
gatctgctgggttcgcagggcgtgccgccgcaacgcatccgcagcctgctggccgatgcc
tgcgtgatgcccgtgctgaccgcccaccccaccgaggtgcagcgcaaaagcaccctggat
gagcaccgcgatatcgccgcgctgatcgcgcagcgcgaccagcccctgaccgcggaggaa
gccgaagagatcgacgccgcgctgctggggcacatcgacacgctgtggcagacgcgcatg
ctgcgctacacccgcctgacggtggctgacgaaatcgagaacgccctgtcgtactaccgc
agcaccttcctgagcgccgtgccgcgcctgtacggcgatctggcgcgcctgctgaccccg
gacagcaagcatcccttcgcgccgccgcccgccccgctggagcccttcctgcgcatggga
agctggatcggcggcgaccgcgacggcaatccgaatgtcgacgccgacacgctggagctt
gccgtgctgcgccaggccaccgtgctgttcgaacattatctcggccaggtgcatgccctg
agcaccgagctgtcgatcacgcggctgctcatcaacgccagcgacgaactgcgccaattg
gccgaagccagcggcgacacctcgccgcatcgccgcgatgagccctatcgccgcgcgctc
ctcggcatctacgcgcgcctggccgctaccgcacgcacgctgatcgggcgcgagctggcc
cgccgcacgccgctgccggccgaaccctacgcccatccccaggagctggcccgcgatctg
gccgtggtggccgattcgctggcccagaacaacggcgcgcccatcgccaagctgcgcctg
accggcctgcagcaggccatcgaggtcttcggctttcacctggccacgctggacctgcgc
cagagctcggatgtgcacgaacgcgttctgaccgaactgttcgcccgcgccggccacccc
gaagcctacgaccagctggacgaggaagcgcgcgtcgcgctgctgcgccaggagctggcc
accggccgccccctggcctcgccctggatcgaatacagcgatgaaaccacccgcgaactg
ggcgtgctgcgcgcggcggctgcggcccgggcgcgctttggcaagcccgcggtgcgccag
accatcgtgtcgcataccgaaacgctgagcgacctgctggaagtgctggtgctgcagaag
gaaaccggcctgatcgacccggcctcgccccagccggaagacggcctgatggtggtgccg
ctgtttgaaaccattcccgacctggagcgcggcccggccatcatggccgcctggctggac
ctgcccgaggtcagcgcccgcgtgcgcctggcccagggccagacccaggaagtgatgctg
ggctactccgacagcaacaaggatggcggctacctcacctcgaactgggcgctgtaccgt
gccgagcgcgaactggttgacgtcttccgggcccgcaaggtgcggctgcgcctgttccat
ggccggggcggctcggtcggccggggtggcggctccagcttcgacgccattctggcgcag
cctccgggcacggtggccggccagttgcgcctgaccgagcagggcgaagtgatccagacc
aagtacaaggatgccgagatcggccggcgcaatctggaactgctggtgtccgccgtgctg
gagtcctcgctggcccagcaaccggccgcacgccaggccgaagatgcccacatggcccat
catggccagaccatggacttcctgtccgaggcagcccagcgcagctatcgcgagctggtg
tatgaaacgccgggcttctccgagtatttcttcgcctccacgcccatcctggagatcgcc
gacctgaacatcggctcgcgcccggcctcgcgcaagcagggccagcgcatcgacgatctg
cgcgccatcccgtggggcttctcgtgggcacaatgccgcctcatgctgaccggctggtac
ggcgtggggtcggcactggaagcctatctggagcaaggcgcgccgggtgcgccgcgcagc
aaacgcgcccgcctggcgcaattgcgcgaaatggcccaggaatggccggccttccgcagc
ctgctctccaatatggagatggtgctggccaagtcggatctggcgatcgcctcgcgctac
gccatgctggtgccgcagcgccgggtgcgcgaacgcattttcggcgccatttccgaagag
cacggccgcacgctggccatgctcaagcaggtcaaccagcgcgaactgctggccgacaac
ccggcgctggcggcgtcgctgcgcgaacgcttcgcctatatcgatccgctcaattatctg
cagatcgatctcatccggcgtcaccgcgccgcccagcgccgccccgacgccacgccggac
ccgcgcgtgccgcgcgccatccacctgaccatcaacggcatcgctgccggcctgcgcaac
tcaggctga

DBGET integrated database retrieval system