KEGG   Bordetella trematum: SAMEA390648701622Help
Entry
SAMEA390648701622 CDS       T04322                                 

Gene name
gst_2
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
btrm  Bordetella trematum
Pathway
btrm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAMEA390648701622 (gst_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btrm02000]
    SAMEA390648701622 (gst_2)
Enzymes [BR:btrm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SAMEA390648701622 (gst_2)
Transporters [BR:btrm02000]
 Other Transporters
  Pores ion channels [TC:1]
   SAMEA390648701622 (gst_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_2 GST_C GST_C_3 GST_N GST_N_3 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: SAI69034
UniProt: A0A157R9N6
LinkDB All DBs
Position
1:1698219..1698827
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPAACSLAPHIVLREAGLDFHLERVDTGLHQTAGGADYYAINPLGMVPVLELADG
TRLTEGPVIAQYIADQAGATTLMPEAGSMQRYRVMEWQNYITSELHKSFTPLFHNDVDSA
AKSSLAGVLRKKLERLNDQLAHGHYLTGEAFTAADAYLFVVLGWAKFVSLDTSDLIHLQQ
FMQRVQARPSVREAMQAEGLRA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtattactcacccgccgcctgttctttggcgccccatatcgtgctgcgcgaa
gcgggcctggattttcatttggagcgggtggataccggcctgcaccaaacggcaggggga
gccgactactacgccatcaaccccctgggcatggtgccggtgttggagcttgcagacggt
acacggctgacggagggcccggttattgcccagtacatcgccgaccaagccggcgccacc
accctcatgcccgaagcgggcagcatgcagcgctatcgggtgatggaatggcaaaactac
attaccagtgagctgcacaagtcgtttacgccgctgttccacaacgatgtggatagcgca
gccaaatcgtcgttagccggggtgttgcgcaaaaagctggaacggttgaacgatcagctg
gcgcatggacactatctgacaggcgaggcttttaccgccgctgacgcctatctgtttgtg
gtgctgggctgggccaagtttgtgagcctggatacaagcgatctgattcatttgcagcag
ttcatgcagcgggtgcaggcccgaccatcggttcgtgaagccatgcaggccgaagggctg
cgggcttga

DBGET integrated database retrieval system