KEGG   Bordetella trematum: SAMEA390648702011Help
Entry
SAMEA390648702011 CDS       T04322                                 

Gene name
gadA2
Definition
(GenBank) glutamate decarboxylase alpha/beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
btrm  Bordetella trematum
Pathway
btrm00250  Alanine, aspartate and glutamate metabolism
btrm00410  beta-Alanine metabolism
btrm00430  Taurine and hypotaurine metabolism
btrm00650  Butanoate metabolism
btrm01100  Metabolic pathways
btrm01110  Biosynthesis of secondary metabolites
btrm01120  Microbial metabolism in diverse environments
btrm02024  Quorum sensing
Module
btrm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAMEA390648702011 (gadA2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAMEA390648702011 (gadA2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAMEA390648702011 (gadA2)
   00430 Taurine and hypotaurine metabolism
    SAMEA390648702011 (gadA2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAMEA390648702011 (gadA2)
Enzymes [BR:btrm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SAMEA390648702011 (gadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Fucose_iso_N2
Motif
Other DBs
NCBI-ProteinID: SAI69978
UniProt: A0A157PMR9
LinkDB All DBs
Position
1:complement(2114944..2116344)
Genome map
AA seq 466 aa AA seqDB search
MPLHAKDTVRADLLDDVYASSDLSVAMPKYKLPAEGHAPRHAYQVVHDELMLDGNSRQNL
ATFCQTWVDEEVHKLMDESIDKNMIDKDEYPQTAEIEARCVHMIADLWHSPDAMNTLGCS
TTGSSEAAMLGGLAMKWAWRKKRQAAGLPTDRPNLICGPVQICWHKFARYFDVELREIPM
EQDRLIMSPEEVIKRCDENTIGVVPTLGVTFSCDYEPVKAVHDALDKLQQDTGLDIPIHV
DGASGGFLAPFCAPDLEWDFRLPRVVSINTSGHKFGLAPLGVGWIVWRDAAHLPEELIFD
VNYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGREGYTRIQQACYDTAQYLADEIARLGP
FEMLFDGNPQKGIPALCWKIKDGQKDLGFNLYDLADRLRSRGWQVPAYSMPAHREDLVVQ
RILVRHGVSRDLASLLIEDFKRALAYFARHPVAVQGSEDESGGFHH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcacgccaaggacacggtccgtgccgacctgctcgatgacgtctacgcgtcg
agcgatctctcggtagccatgcccaagtacaaactcccggccgagggacatgcgccgcgc
catgcctatcaggtcgtgcacgacgaactgatgctggacggaaactcgcgtcagaatctg
gccaccttctgccagacatgggtggacgaggaagtccacaagctgatggacgagtcgatc
gacaagaacatgatcgacaaggatgaatacccccagacagcggaaatcgaagcgcgctgc
gtgcacatgatcgccgacctgtggcactcgcccgatgcgatgaacaccctgggctgctcg
accacgggctcatccgaagccgccatgctgggcggactggccatgaaatgggcctggcgg
aaaaaacgccaggccgccggcctgccgaccgaccggcccaacctgatctgcggcccggtg
cagatctgctggcacaagttcgcgcgctacttcgacgtcgagctgcgcgagatcccgatg
gagcaagaccggctcatcatgagcccggaagaagtcatcaagcgttgcgacgagaacacc
atcggcgtggtacccacgctgggcgtgacgttctcgtgcgattacgagccggtcaaggcc
gtgcacgatgcgctcgacaaactgcaacaggacaccggtctggatatccccattcacgtc
gatggcgccagcggcggcttcctggccccgttctgcgcccccgatctggagtgggacttc
cgcctgccgcgcgtggtgtcgatcaacacctccggccacaagttcgggctggcgccgctg
ggggtgggctggatcgtctggcgcgatgccgcccacctgcccgaggaactgatcttcgac
gtgaactacctgggcggcaacatgcccaccttcgcgctgaacttctcgcgaccgggcggc
cagatcgtggcccagtactacaactttctgcgtctgggccgcgagggatacacccgcatc
cagcaggcctgctacgacacggcgcagtacctggcggacgagatcgccaggctggggccc
ttcgagatgctgttcgacggcaatccgcaaaagggcattccggcactgtgctggaagatc
aaggacggccagaaagacctcggcttcaatctctacgatctggccgaccggctgcgttcg
cgcggctggcaggtgccggcctactcgatgccggcccatcgcgaagacctggtggtgcaa
cgcatcctggtgcgccatggcgtcagccgcgacctggcctcgctgctgatcgaggacttc
aagcgcgcgctggcgtatttcgcgcgccacccggtggccgtccagggatcggaagacgaa
tcgggcggctttcatcactga

DBGET integrated database retrieval system