KEGG   Bordetella trematum: SAMEA390648702645Help
Entry
SAMEA390648702645 CDS       T04322                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
btrm  Bordetella trematum
Pathway
btrm00020  Citrate cycle (TCA cycle)
btrm00190  Oxidative phosphorylation
btrm00650  Butanoate metabolism
btrm01100  Metabolic pathways
btrm01110  Biosynthesis of secondary metabolites
btrm01120  Microbial metabolism in diverse environments
btrm01130  Biosynthesis of antibiotics
btrm01200  Carbon metabolism
Module
btrm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btrm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
btrm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAMEA390648702645 (sdhA)
   00650 Butanoate metabolism
    SAMEA390648702645 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAMEA390648702645 (sdhA)
Enzymes [BR:btrm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAMEA390648702645 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SAMEA390648702645 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 HI0933_like FAD_binding_3 GIDA Lycopene_cycl Pyr_redox_3 NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: SAI71158
UniProt: A0A157MZM7
LinkDB All DBs
Position
1:2778269..2780047
Genome map
AA seq 592 aa AA seqDB search
MVAVMNSLPRRQFDVVVVGAGGAGLRCSLQLSQAGLSVAVLSKVFPTRSHTVAAQGGVSA
ALGNMSEDNWYWHMYDTVKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANFGEKPVQRACASADRTGHALLHTLYQRNVAARTQFFVEWMALDLLRNADG
DVVGVTALEMETGEIYILEAKTTVLATGGAGRIWAASTNAFINTGDGLGMAARAGIPLQD
LEFWQFHPTGVAGAGVLITEGVRGEGGILLNKDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPDGSYVVLKLDHLGADVINKRLPSIREIAIKFGNVDPIKEPIPVVPTIHYQ
MGGIPANYHGQVLEYINGENRIVNGLYAVGECAAVSVHGANRLGTNSLLDLIVFGRATGN
HIVESHPERQRAHQPLPKEAVDFSLNRVNELESRTSGEKTQDVANAIRISMQRHCGVFRT
LDLLNEGVEQIEDLAKVAKSIYFKDKSKVFNTARVEALELANMTEVARATIKSAANRTES
RGAHALNDFPNRDDENWLKHTLWYSEGSRLDYKPVQMKPLTVESFPPKARTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgctgtcatgaattccttgccgcgccgccaatttgatgtggtggtcgtaggcgcc
ggtggagccggcctgcgctgttcgctgcaactgtcccaggcgggactctcggttgcggtc
ctgtccaaagtgttccccacgcgctcgcacaccgttgcggcgcagggcggcgtgagcgcc
gcgctgggcaacatgagcgaagacaactggtactggcacatgtacgacaccgtcaagggg
tcggactggctgggtgaccaggatgccatcgagttcatgtgccgcgaagcgcccaacgcc
gtgtacgagctggaacacttcggcatgccgtttgaccgtaacgccgacggcacgatctac
cagcgtccgtttggcggtcacaccgccaacttcggcgagaagccggtgcagcgcgcctgt
gcctctgctgaccgcacgggccacgccctgctgcacacgctctatcagcgcaacgttgcc
gcccgcacccagttcttcgtcgagtggatggcgctggacctgctgcgcaacgccgatggc
gacgtggtgggcgtgaccgccctcgaaatggaaacgggcgagatctacatcctggaagcc
aagaccacggtgctggccaccggcggcgccggccgtatctgggctgcatcgaccaacgcc
ttcatcaacaccggtgacggcctgggcatggcggcgcgcgccggcatcccgctgcaggac
ctggagttctggcagttccacccgactggcgtggccggcgcgggcgtgctgatcaccgaa
ggcgtgcgtggcgaaggcggcatcctgctgaacaaggatggcgagcgcttcatggagcgc
tatgcgcccacgctgaaggatctggctccgcgcgacttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgtggctgcggtcctgacggcagctacgtggtgctgaagctggat
cacctgggcgccgacgtcatcaacaagcgtctgccctcgatccgcgagatcgccatcaag
ttcggcaacgtcgacccgatcaaggaaccgatcccggtcgtgccgacgattcactaccag
atgggcggcatcccggccaactatcacggccaggtgctcgagtacatcaacggcgaaaac
cgcatcgtcaacggcctgtacgcggtcggcgagtgcgccgccgtgtcggtgcacggcgcc
aaccgcctgggcaccaactcgctgctggacctgatcgtgttcggtcgcgccaccggcaac
cacatcgtcgagtcgcaccccgagcgtcagcgcgctcaccagccgctgcccaaggaagcc
gtcgatttctcgctcaaccgcgtcaacgagctcgaatcgcgcacttccggcgagaagacc
caggacgtggccaacgccatccgcatctcgatgcagcgtcactgcggcgtgttccgcacg
ctggacctgctcaacgagggcgtcgagcagatcgaagatctggccaaggtcgccaagagc
atctacttcaaggacaagtccaaggtgttcaacaccgcgcgcgtcgaggcgctggaactg
gccaacatgaccgaagtagcccgtgccacgatcaagtcggccgccaaccgtacggaaagc
cgtggcgctcacgccctgaacgacttcccgaaccgcgacgacgagaactggctcaagcac
acgctgtggtattccgaaggcagccgcctggattacaaaccggtgcagatgaagcccttg
acggtcgagtccttcccgcccaaggcccgtactttctaa

DBGET integrated database retrieval system