KEGG   Bordetella trematum: SAMEA390648702646Help
Entry
SAMEA390648702646 CDS       T04322                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
btrm  Bordetella trematum
Pathway
btrm00020  Citrate cycle (TCA cycle)
btrm00190  Oxidative phosphorylation
btrm00650  Butanoate metabolism
btrm01100  Metabolic pathways
btrm01110  Biosynthesis of secondary metabolites
btrm01120  Microbial metabolism in diverse environments
btrm01130  Biosynthesis of antibiotics
btrm01200  Carbon metabolism
Module
btrm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btrm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
btrm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAMEA390648702646 (sdhB)
   00650 Butanoate metabolism
    SAMEA390648702646 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAMEA390648702646 (sdhB)
Enzymes [BR:btrm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAMEA390648702646 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SAMEA390648702646 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: SAI71160
UniProt: A0A157SL08
LinkDB All DBs
Position
1:2780060..2780776
Genome map
AA seq 238 aa AA seqDB search
MSNKRIVKFEIYRYDPDKDERPYMQKLEVELEPTDKMLLDALVRIKNDVDDSLAMRRSCR
EGVCGSDAMNINGKNGLACTTNLRELKEPIVLKPLPGLPVIRDLIVDMTHFFNQYHSVSP
FLINDTPPPEHERLQSPEAREELDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYR
FIADSRDEATARRLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataagcgaatcgttaaattcgaaatctaccgctacgatccggacaaggacgag
cgtccctatatgcagaagcttgaggtcgagcttgagccgaccgacaagatgctgctcgat
gcgctggtgcgtatcaagaacgacgtcgacgacagcctggccatgcgccggtcctgccgc
gaaggcgtgtgcggttccgatgccatgaacatcaatggcaagaacggcctggcctgcacg
accaacctgcgtgaactgaaagaaccgatcgtgctcaagccgctgcccggcttgcccgtg
atccgcgacctgatcgtggacatgacgcacttcttcaatcagtaccactcggtcagcccg
ttcctgatcaacgacacgccgccgcccgagcacgagcgtctgcagtcgcccgaagcgcgt
gaagagctggatggtctgtacgagtgcattctgtgcgcctgctgctcgacctcctgcccg
tcgttctggtggaaccccgacaagttcgtcggccccgccggcctgctgcaggcctatcgc
tttatcgcggacagccgcgatgaagccaccgcccgccgcctggacaacctggaagacccg
tatcgtctgttccgctgccacacgatcatgaactgtgtcgacgtctgtcccaagggactg
aacccgaccaaggcgatcggcaagatcaaggaattgatggtccggcgtacggtctaa

DBGET integrated database retrieval system