KEGG   Bordetella trematum: SAMEA390648703544Help
Entry
SAMEA390648703544 CDS       T04322                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
btrm  Bordetella trematum
Pathway
btrm00564  Glycerophospholipid metabolism
btrm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAMEA390648703544 (glpD)
Enzymes [BR:btrm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SAMEA390648703544 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like Pyr_redox_2 GIDA NAD_binding_8 Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: SAI73153
UniProt: A0A157R4J1
LinkDB All DBs
Position
1:3796205..3797800
Genome map
AA seq 531 aa AA seqDB search
MKPTVPPATRAQLLDRLQSPDPWDVIVIGGGATGLGTAVDAAARGFRTLLIEGEDFARGT
SSKATKLVHGGVRYLAQGNISLVREALHERGLLNQNAPHLAWPLGFVVPAYSLLDQPFYG
AGLKMYDMLAGKLNLSPSRWLSRNETLEHAGTLAPVVQGRRLRGGVLYFDGQFDDARLAM
ALMRTLFDLGGTAVNYLRVTGLSRDASGRITGVQTRDALDGTEHAIQGKCIINATGVWVD
AVRRMDNADAATLVAPSQGVHLTLPRSFLPGSDAVLIPKTADGRVLFMVPWNGHTIVGTT
DTPRQDLPLDPRPQPGEVDFILATAARYLTRKPTLDDVTSVWAGLRPLVKATGEAATKSL
SREHTILVSASGLITVTGGKWTTYRKMAQDVIDTAISKQLLPQAACRSADLRLHGAPAPG
HTLEARTGTPDSYYGTDLATLHALPGADRMLVNASGLSEAHVRYAARCELARTVEDVLAR
RNRALFLDAEAALLAAPEVARLLAEELGHDSAWQQRTLEDFAKVAATFRLQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctaccgttcctcccgccacccgcgcccaacttctggatcgcctgcaatcgcct
gacccctgggacgtgatcgtcatcggcggcggcgccaccggcctgggcacggcggtcgat
gccgccgcgcgcggctttcgcaccctgctgatcgaaggcgaggatttcgcacgcggcacc
tccagcaaggcgaccaagctggtgcatggcggcgtgcgctatctcgcccagggcaacatc
agcctggtgcgcgaggcgctgcacgaacgcggcctgctgaaccagaatgcgccccacctg
gcatggccgctgggctttgtggtgcccgcctactccctgctggatcagccgttttacggc
gccgggctgaagatgtacgacatgctggccggcaagctgaacctgtcgcccagccgctgg
ctgtcgcgcaacgaaaccctggaacatgccggcacgctggcccccgtggtgcaaggccgt
cgcctgcgcggcggcgtgctgtacttcgacggccagttcgacgatgcgcgcctggccatg
gcgctgatgcgcacgctgttcgacctgggcggcaccgccgtcaactacctgcgcgtcacg
gggctgagccgcgatgccagcggacgcatcaccggcgtgcagacccgggatgccctggat
ggcaccgagcatgccatccagggaaagtgcatcatcaacgccaccggcgtctgggtcgac
gccgtgcgccgcatggacaatgccgacgccgccaccctggtcgcgcccagccagggggtg
cacctcaccctgccgcgcagtttcctgcccggctcggatgccgtcctgattcccaagact
gccgacggccgcgtgctgttcatggtgccctggaacggccacaccatcgtcggcaccacc
gacaccccgcgtcaggatctgcccctggatccgcgcccccagcccggcgaggtggatttc
atcctggccaccgccgcccgctacctgacccgcaagcccacgctggacgatgtcaccagc
gtatgggccggattgcgccccttggtcaaggccacgggcgaagccgccaccaaatccctg
tcgcgcgaacacaccattctggtgtcggccagcggcctgatcacggtcaccggcggcaaa
tggacgacctatcgcaagatggcccaggatgtgatcgacacggcgatctccaagcagttg
ctgccgcaagccgcctgccgcagcgccgatctgcgtctgcacggcgccccggcgccgggc
cacacgctggaggcgcgcaccggcacgccggacagttattacggcaccgacctggcgacc
ctgcacgccctgcctggcgccgaccgcatgctggtcaatgccagcggcctgagcgaggcc
cacgtgcgctatgccgcccgttgcgaactggcccgcaccgtcgaggacgtgctggcgcgc
cgcaaccgcgcgctctttctggatgccgaggcagccctgctggccgcgccggaagtcgcc
cgcctgctggccgaagaactgggccacgacagcgcctggcagcaacgcacgctggaggac
ttcgccaaggtggcggccaccttccggctgcaatga

DBGET integrated database retrieval system